ESTScan Details for Unigene SGN-U340781

Score 
203
Direction 
Forward
Predicted Peptide Sequence 
TLKAEASNLKNQRASPFIIKTHLSQDPFYATKIIRFYALNNDIISAHKVFDKTPHRTIYLWNSLIRGYARAHKFRNAFSLFNDMLHSQIM
PDNFTYACLVKASSENFDLHSLRVLHGGVVLSGLRLDFICSSQLGSAYSRLGCIADAKQGVFWDNGAGFGLMEFNVIKLMGVLGELEKGN
SVGLVKMQIMGGX
Predicted Coding Sequence 
ACTCTCAAAGCTGAAGCTTCCAATCTCAAGAACCAAAGAGCTTCACCTTTCATAATCAAGACTCATCTCTCACAAGACCCATTTTACGCT
ACAAAAATTATAAGATTCTATGCTCTAAACAACGACATCATCTCTGCACACAAAGTGTTTGATAAAACTCCTCATCGAACCATTTACCTC
TGGAACTCCTTAATTCGAGGTTATGCCAGAGCCCACAAGTTTAGAAATGCATTTTCGCTGTTTAATGATATGCTTCATTCTCAAATAATG
CCTGATAACTTCACTTATGCATGCCTTGTAAAAGCCAGCTCTGAGAATTTTGATTTGCACAGCTTGAGAGTTTTACATGGAGGGGTTGTT
CTATCTGGGTTGCGGTTGGACTTTATCTGTAGTAGTCAACTTGGTAGTGCTTATTCAAGATTAGGCTGTATAGCTGATGCXAAGCAAGGT
GTTTTCTGGGATAACGGAGCCGGATTTGGTCTTATGGAATTCAATGTTATCAAGTTAATGGGGGTCTTGGGGGAATTGGAGAAAGGGAAT
AGCGTTGGTTTAGTAAAAATGCAGATAATGGGGGGGGXX
Edits in Original Sequence 
GTGAAATGTGCTGATGTTCATCCCCTTCAACTGCCTTGTTGCTCAACTCTCAAAGCTGAAGCTTCCAATCTCAAGAACCAAAGAGCTTCA
CGCTTTCATA
(5')ACTCTCAAAGCTGAAGCTTCCAATCTCAAGAACCAAAGAGCTTCACgCTTTCATAATCAAGACTCATCTCTCACAA
GACCCATTTTACGCTACAAAAATTATAAGATTCTATGCTCTAAACAACGACATCATCTCTGCACACAAAGTGTTTGATAAAACTCCTCAT
CGAACCATTTACCTCTGGAACTCCTTAATTCGAGGTTATGCCAGAGCCCACAAGTTTAGAAATGCATTTTCGCTGTTTAATGATATGCTT
CATTCTCAAATAATGCCTGATAACTTCACTTATGCATGCCTTGTAAAAGCCAGCTCTGAGAATTTTGATTTGCACAGCTTGAGAGTTTTA
CATGGAGGGGTTGTTCTATCTGGGTTGCGGTTGGACTTTATCTGTAGTAGTCAACTTGGTAGTGCTTATTCAAGATTAGGCTGTATAGCT
GATGCXAAGCAAGGTGTTTTCTGGGATAACGGAGCCGGATTTGGTCTTATGGAATTCAATGTTATCAAGTTAATGGGGGTCTTGGGGGAA
TTGGAGAAAGGGAATAGCGTTGGTTTAGTAAAAATGCAGATAATGGGGGGGGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan