ESTScan Details for Unigene SGN-U340957

Score 
98
Direction 
Forward
Predicted Peptide Sequence 
MDVTSDDYSTKQSLNNKDDLFLPTGTTSTQDALYRIAFLTAIAIFQLPFERIKEDLVPTVIFTRKPLLFQGFVVSLMFAFSGSMASESMN
EKQPKMALLCHKLAMFAVAVAGGVFALSSLLSYYNIEMVPDVVQTPSLYDEYKIYDLLESCKKKKKKLEGGPXYPIRPIVSRITIHWPSF
LHVVTGKTLALPNLIALAAHPPFGSWRNNEEAPARSPFPQLARLDANGKLKALYFGKIPVKFLLNSSFLTNRRNRQIPLFKDIPNRVKVG
QFGTKSL
Predicted Coding Sequence 
ATGGATGTAACAAGTGATGATTACTCTACAAAGCAATCTTTGAATAACAAAGATGATCTATTTCTTCCCACAGGCACAACTAGCACTCAA
GATGCTTTATACAGAATTGCATTTTTGACAGCTATTGCAATTTTTCAGCTTCCATTTGAGAGGATAAAAGAAGATTTAGTACCAACTGTG
ATATTCACAAGAAAGCCTCTTCTCTTTCAAGGATTTGTTGTTTCTCTCATGTTTGCATTCTCAGGTTCGATGGCGTCGGAATCCATGAAC
GAAAAACAGCCAAAGATGGCATTATTATGTCACAAGCTGGCTATGTTTGCAGTAGCAGTTGCAGGGGGAGTATTTGCCTTGTCGAGTCTA
CTGTCATATTACAATATTGAGATGGTGCCTGATGTTGTGCAAACGCCGAGTTTATACGATGAATATAAAATATATGATCTGCTTGAAAGT
TGTAAAAAAAAAAAAAAAAAACTCGAGGGGGGGCCCGXGTACCCAATTCGCCCTATAGTGAGTCGTATTACAATTCACTGGCCGTCGTTT
TTACACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGCCCTTGCAGCACATCCCCCTTTCGGCAGCTGGCGTAATAACGAA
GAGGCCCCXGCACGATCGCCCTTCCCACAGTTGGCCCGCCTGGATGCCAATGGCAAATTGAAAGCGTTATATTTTGGTAAAATTCCCGTT
AAATTTTTGTTAAACAGCTCATTTTTAACCAATAGGCGAAATCGGCAAATCCCTTTATTCAAAGATATACCCAATAGGGTAAAGGTTGGT
CAGTTTGGAACAAAGTCCCTATAA
Edits in Original Sequence 
TTTTTCACAAGATTTTCAATAGGATGGATGTAACAAGTGATGATTACTCTACAAAGCAATCTTTG(5')ATGGATGTAACAAGTGATGAT
TACTCTACAAAGCAATCTTTGAATAACAAAGATGATCTATTTCTTCCCACAGGCACAACTAGCACTCAAGATGCTTTATACAGAATTGCA
TTTTTGACAGCTATTGCAATTTTTCAGCTTCCATTTGAGAGGATAAAAGAAGATTTAGTACCAACTGTGATATTCACAAGAAAGCCTCTT
CTCTTTCAAGGATTTGTTGTTTCTCTCATGTTTGCATTCTCAGGTTCGATGGCGTCGGAATCCATGAACGAAAAACAGCCAAAGATGGCA
TTATTATGTCACAAGCTGGCTATGTTTGCAGTAGCAGTTGCAGGGGGAGTATTTGCCTTGTCGAGTCTACTGTCATATTACAATATTGAG
ATGGTGCCTGATGTTGTGCAAACGCCGAGTTTATACGAtTGAATATAAAATATATGATCTGCTTGAAtAGTTGTAAAAAAAAAAAAAAAA
AACTCGAGGGGGGGCCCGXGTACCCAATTCGCCCTATAGTGAGTCGTATTACAATTCACTGGCCGTCGTTTTTACACGTCGTGACTGGGA
AAACCCTGGCGTTACCCAACTTAATCGCCCTTGCAGCACATCCCCCTTTCGGCAGCTGGCGTAATAACGAAGAGGCCCCXGCACGATCGC
CCTTCCCACAGTTGGCCCGCCTGGATGCCAATGGCAAATTGAAAGCGTTATATTTTGGTAAAATTCCCGTTAAATTTTTGTTAAACAGCT
CATTTTTAACCAATAGGCGAAATCGGCAAATCCCTTTaATTCAAAGATATACCCAATAGGGTAAAGGTTGGTCAGTTTGGAACAAAGTCC
CTATAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan