Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U341023

Score 
-292
Direction 
Reverse
Predicted Peptide Sequence 
SDCATVGRAIGAGLFAITPAGERGMCCKAIKLGNARVFPVTTVVKRRPVNCNTTHYRANWVPGPXLEILIHEKGYEKFGRTHIRNEGDPC
KYIVSYSYKGTLSPNMVSLMPLSRSWLWNLSKTQNHGSHRAPAKSFIPTPTK
Predicted Coding Sequence 
XATTCAGACTGCGCAACTGTGGGAAGGGCGATCGGTGCGGGCCTCTTCGCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCG
ATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACXGTTGTAAAACGACGGCCAGTGAATTGTAATACGACTCACTATAGGGCGAAT
TGGGTACCGGGCCCCXCCCTCGAGATTCTAATCCACGAAAAAGGATACGAGAAATTTGGAAGAACTCATATACGGAATGAGGGCGACCCA
TGTAAATACATCGTTTCTTACTCGTACAAAGGAACTCTTTCTCCGAATATGGTTTCTCTCATGCCACTTTCTCGTTCGTGGTTATGGAAT
TTGTCAAAAACCCAAAATCATGGTAGTCATCGXGCTCCTGCAAAGTCGTTCATTCCGACCCCTACAAAGTAA
Edits in Original Sequence 
(5')XATTCAGACTGCGCAACTGTGGGAAGGGCGATCGGTGCGGGCCTCTTCGCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAA
GGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACXGTTGTAAAACGACGGCCAGTGAATTGTAATACGACTCACTATAGGGC
GAATTGGGTACCGGGCCCCXCCCTCGAGATTCTAATCCACGAAAAAGGATACGAGAAATTTGGAAGAACTCATATACGGAATGAGGGCGA
CCCATGTAAATACATCGTTTCTTACTCGTACAAAGGAACTCTTTCTCCGAATATGGTTTCTCTCATGCCACTTTCTCGTTCGTGGTTATG
GAATTTGTCAAAAACCCAtAAATCATGGTAGTCATCGXGCTCCTGCAAAGTCGTTCATTCCGACCCCTACAAAGTAA(3')TATCTTTGT
ATTCTTTGTAATGCGCTTTCTTTGCTTTCTTTTAGAATCTTAAGGTCCTGGAATATTTTTTTTACGTTAGTGTGTGTTCCATATAGAATT
C

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan