ESTScan Details for Unigene SGN-U341081

Score 
-38
Direction 
Reverse
Predicted Peptide Sequence 
LTVAISHSGGATVGKGDGAGLFAITPAGERGMCCKAIKVGNARVFPVTTVVKRRPVNCNTTHYRANWVPGPXLEFFVNIELQPWFSQKII
DMMAWFGFELGKGLGAKLQGIVEPIQPVRHSTTFGLGYKYTTEEWLDWRPPRDGYYYPLKKPIPPLYQSFRLAGFMGDNIDEISDDLKGL
SLTKEEGKVCNVVINEEEKGGPSGSKEAKISAATGPRLHPDLVEYLGALEDVFLSSFNSNKGVSLQPGGSTSSRAAATAVELQLM
Predicted Coding Sequence 
XCGCTTACAGTTGCCATTAGCCATTCAGGTGGCGCAACTGTTGGAAAGGGCGATGGTGCGGGCCTCTTCGCTATTACGCCAGCTGGCGAA
AGGGGGATGTGCTGCAAGGCGATTAAGGTGGGTAACGCCAGGGTTTTCCCAGTCACGACXGTTGTAAAACGACGGCCAGTGAATTGTAAT
ACGACTCACTATAGGGCGAATTGGGTACCGGGCCCCXCCCTCGAGTTTTTTGTTAATATTGAGTTGCAACCTTGGTTCAGCCAAAAAATC
ATAGATATGATGGCCTGGTTCGGTTTCGAGCTTGGGAAAGGTTTGGGGGCTAAATTACAAGGGATAGTCGAACCTATACAGCCTGTTCGA
CATTCCACCACTTTTGGTTTGGGTTATAAATACACCACCGAAGAATGGCTCGATTGGCGACCACCTAGAGATGGGTACTACTATCCATTG
AAGAAACCCATACCGCCATTGTATCAATCATTTCGATTAGCAGGTTTCATGGGAGACAATATTGATGAGATCTCAGACGACTTGAAGGGG
TTATCGCTAACCAAAGAAGAAGGGAAAGTTTGCAACGTCGTGATCAACGAGGAGGAGAAAGGGGGCCCTAGTGGAAGCAAGGAGGCAAAG
ATCAGCGCAGCAACTGGACCTCGACTCCATCCAGACCTTGTCGAGTATCTGGGTGCCTTGGAAGATGTTTTTCTATCAAGTTTTAATTCA
AATAAAGGAGTTTCXCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCGCCACCGCGGTGGAGCTCCAGCTTATG
Edits in Original Sequence 
(5')XCGCTTACAGTTGCCATTAGCCATTCAGGTGGCGCAACTGTTGGAAAGGGCGATcGGTGCGGGCCTCTTCGCTATTACGCCAGCTG
GCGAAAGGGGGATGTGCTGCAAGGCGATTAAGGTGGGTAACGCCAGGGTTTTCCCAGTCACGACXGTTGTAAAACGACGGCCAGTGAATT
GTAATACGACTCACTATAGGGCGAATTGGGTACCGGGCCCCXCCCTCGAGTTTTTTGTTAATATTGAGTTGCAACCTTGGTTCAGCCAAA
AAATCATAGATATGATGGCCTGGTTCGGTTTCGAGCTTGGGAAAGGTTTGGGGGCTAAATTACAAGGGATAGTCGAACCTATACAGCCTG
TTCGACATTCCACCACTTTTGGTTTGGGTTATAAATACACCACCGAAGAATGGCTCGATTGGCGACCACCTAGAGATGGGTACTACTATC
CATTGAAGAAACCCATACCGCCATTGTATCAATCATTTCGATTAGCAGGTTTCATGGGAGACAATATTGATGAGATCTCAGACGACTTGA
AGGGGTTATCGCTAACCAAAGAAGAAGGGAAAGTTTGCAACGTCGTGATCAACGAGGAGGAGAAAGGGGGCCCTAGTGGAAGCAAGGAGG
CAAAGATCAGCGtCAGCAACTGGACCTCGACTCCATCCAGACCTTGTCGAGTATCTGGGTaGCCTTGGAAGATGTTTTTCTATCAAGTTT
TAATTCAAATAAAGGAGTTTCXCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCGCCACCGCGGTGGAGCTCCAGCTTATG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan