ESTScan Details for Unigene SGN-U341222

Score 
556
Direction 
Forward
Predicted Peptide Sequence 
GGLXSXNTKVRENEGAAVSHRTSGSPGQQEIGTRKPLSIHGDGSNVEVILYCEDVAEAFEVVLHRGDVGHVYNIGTNKERRVIDVAKDIS
NLFNKDPDTSIQFVENRPFNDQRYFLDDQKLKNLGWSEKTTWEEGLKKTMEWYVNNPDWWGDVSXALLPHPTMLMMPGGVERNSDGAEKG
DSGSSEISGNTKPNGMVVPASKISNSPSKSPHKFLIYGKTGWIGGLLNKLFEKQGIPFEXLTGTSGGTLTTLVRHFFLETPHVFHACGSL
VGPKLIGVGVFKLETILPKLLGP
Predicted Coding Sequence 
XXAGGGGGCTTGNNGTCTGNAAACACGAAAGTAAGGGAAAATGAAGGGGCGGCGGTCAGTCATAGAACAAGTGGATCCCCCGGGCAGCAG
GAAATTGGCACGAGGAAGCCTCTTTCGATTCACGGAGATGGTTCAAATGTTGAAGTTATTCTCTATTGTGAGGACGTTGCTGAAGCTTTC
GAAGTTGTTCTTCACCGAGGTGATGTTGGTCATGTTTATAACATCGGGACTAACAAAGAGAGGCGAGTGATTGATGTTGCCAAAGATATA
TCCAATCTTTTTAACAAGGATCCAGACACAAGCATTCAGTTTGTGGAAAACAGGCCCTTCAATGACCAGAGGTATTTCTTAGATGATCAG
AAGTTGAAGAACCTCGGTTGGTCAGAGAAGACCACCTGGGAAGAGGGTCTGAAAAAAACCATGGAGTGGTATGTCAACAATCCTGATTGG
TGGGGAGATGTCTCANGGGCATTGCTTCCCCATCCTACAATGCTGATGATGCCTGGTGGGGTAGAGAGAAATTCGGATGGAGCTGAAAAA
GGTGATTCTGGATCATCTGAGATCTCAGGAAACACGAAACCTAACGGAATGGTAGTTCCAGCTTCCAAGATCAGCAACTCCCCTAGTAAA
TCACCTCATAAGTTTTTGATTTATGGTAAAACTGGGTGGATTGGTGGTCTCCTTAACAAACTTTTTGAGAAACAGGGGATTCCTTTTGAG
XTTTTGACAGGGACGTCTGGAGGAACCCTCACAACTCTTGTCAGACATTTCTTCTTGGAAACCCCACATGTATTCCATGCTTGTGGGTCA
CTGGTAGGCCCCAAGTTGATTGGGGTGGGAGTCTTTAAACTTGAAACAATCCTCCCAAAGTTGCTTGGACCTTAA
Edits in Original Sequence 
(5')XXAGGGGGCTTGNNGTCTGNAAACACGAAAGTAAGGGAAAATGAAGGGGCGGCGGTCAGTCATAGAACAAGTGGATCCCCCGGGCA
GCAGGAAATTcGGCACGAGGAAGCCTCTTTCGATTCACGGAGATGGTTCAAATGTTaGAAGTTATTCTCTATTGTGAGGACGTTGCTGAA
GCTTTCGAAGTTGTTCTTCACCGAGGTGATGTTGGTCATGTTTATAACATCGGGACTAACAAAGAGAGGCGAGTGATTGATGTTGCCAAA
GATATATCCAATCTTTTTAACAAGGATCCAGACACAAGCATTCAGTTTGTGGAAAACAGGCCCTTCAATGACCAGAGGTATTTCTTAGAT
GATCAGAAGTTGAAGAACCTCGGTTGGTCAGAGAAGACCACCTGGGAAGAGGGTCTGAAAAAAACCATGGAGTGGTATGTCAACAATCCT
GATTGGTGGGGAGATGTCTCANGGGCATTGCTTCCCCATCCTACAATGCTGATGATGCCTGGTGGGGTAGAGAGAAATTCGGATGGAGCT
GAAAAAGGTGATTCTGGATCATCTGAGATCTCAGGAAACACGAAACCTAACGGAATGGTAGTTCCAGCTTCCAAGATCAGCAACTCCCCT
AGTAAATCACCTCATAAGTTTTTGATTTATGGTAAAACTGGGTGGATTGGTGGTCTCCTTAACAAACTTTTTGAGAAACAGGGGATTCCT
TTTGAGXTTTTGACAGGGACGTCTGGAGGAACCCTCACAACTCTTGTCAGACATTTCTTCTTGGAAACCCCACATGTATTCCATGCTTGT
GGGTCACTGGTAGGCCCCAAGTTGATTGGGGTGGGAGTCTTTAAACTTGAAACAATCCTCCCAAAGTTGCTTGGACCTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan