ESTScan Details for Unigene SGN-U341258

Score 
358
Direction 
Forward
Predicted Peptide Sequence 
MSYYSCNSNPXLKTIQSSELFDTWTPQNNICNFTGIFCDSDSKLVKEINLSEQNLSGVVSFDSLCSLKSLQKISLGTNYLYGRVSDHLKN
CTNLQYLDLGSNSFSGEVPNLSSLSQLEFLNLNRSGFSGSFPWRSPSNLTNLTFLSLGDNSFLKXSFPP
Predicted Coding Sequence 
ATGAGTTACTACTCATGCAATTCAAATCCAXCTCTGAAAACAATACAAAGTTCAGAGCTTTTTGACACGTGGACACCTCAGAATAACATT
TGCAACTTCACTGGAATTTTCTGTGATTCTGACAGTAAATTGGTTAAAGAAATCAATCTTTCTGAACAGAATCTATCTGGGGTTGTCTCT
TTTGATTCATTATGTTCTCTGAAATCCCTACAAAAGATATCTCTTGGTACTAATTACTTGTACGGTAGAGTCAGTGACCATTTGAAAAAC
TGTACAAACTTGCAGTATTTGGATTTGGGTAGCAATTCTTTTTCAGGGGAAGTTCCAAATTTGTCTTCTTTAAGCCAATTGGAGTTTTTG
AATCTCAATAGGAGTGGATTCTCTGGTTCATTTCCTTGGAGGTCACCTAGCAATCTTACTAATCTAACTTTCTTGAGTTTGGGTGACAAT
TCATTTCTTAAAAGNTCATTCCCTCCTTGA
Edits in Original Sequence 
CATATTATGTTCCCATAGACTAAACCAAACGTCAAATACAGACAATACCAAACTTTCTTCTCTATTTCTCTTACTAGCCAAAAAAAAAAA
AAATGTCAGCCAGTGACAACTTTTTCCGGCCATTCCCAGTTTTATTGCTCTGTTTTTTAGTTTTCTTGATTTCTCCTTCTCATCAACAAG
ATGAGTTACTACTCATGCAATTCAAATCCACTCTGAAAACAATACAAAGTTCAGAGCTTTTTGACACGTGGACAC
(5')ATGAGTTACTA
CTCATGCAATTCAAATCCAXCTCTGAAAACAATACAAAGTTCAGAGCTTTTTGACACGTGGACACCTCAGAATAACATTTGCAACTTCAC
TGGAATTTTCTGTGATTCTGACAGTAAATTGGTTAAAGAAATCAATCTTTCTGAACAGAATCTATCTGGGGTTGTCTCTTTTGATTCATT
ATGTTCTCTGAAATCCCTACAAAAGATATCTCTTGGTACTAATTACTTGTACGGTAGAGTCAGTGACCATTTGAAAAACTGTACAAACTT
GCAGTATTTGGATTTGGGTAGCAATTCTTTTTCAGGGGAAGTTCCAAATTTGTCTTCTTTAAGCCAATTGGAGTTTTTGAATCTCAATAG
GAGTGGATTCTCTGGTTCATTTCCTTGGAGGTCACCTAGCAATCTTACTAATCTAACTTTCTTGAGTTTGGGTGACAATTCATTTCTTAA
AAGNTCATTCCCTCCTTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan