ESTScan Details for Unigene SGN-U341326

Score 
308
Direction 
Forward
Predicted Peptide Sequence 
MVKLLGMEGQLREAYELVQSLQEPIDSGIWGALLSCCDAHRNYELADIVACRLFGNKLENSSYRIMLSNMYASDGRWDLVNKLRVDSEIT
KLKLPGKSWITSKXNIPLKGTLEVSSVTSFTELTVAESGSEAVRGGGIDLIVLSQRECYHVIPXTNGKEDEFDHSALNLNDSXQYEGSFP
HFCVFFPQTFTMNNHASICXYHGKNMMSTDGXKADKLELTKAKHTRIAYTFXVLDFRDQYDQPLXIGDKTFFPFGSVHXEASADXKLVAL
AAQMVTI
Predicted Coding Sequence 
ATGGTAAAGCTTCTTGGAATGGAAGGACAATTAAGAGAAGCTTATGAACTTGTTCAGTCACTGCAAGAACCAATTGACTCCGGCATTTGG
GGAGCACTATTATCATGCTGTGATGCTCATCGAAATTATGAGTTGGCAGATATTGTAGCTTGTCGTCTTTTTGGGAATAAGCTAGAGAAT
AGTAGTTACAGAATTATGCTTTCAAATATGTATGCTAGTGATGGGAGGTGGGATTTGGTAAATAAGTTGAGAGTAGATTCTGAGATAACA
AAGTTGAAACTTCCTGGAAAAAGCTGGATTACTAGTAAAAAXAACATTCCTTTGAAAGGAACTCTTGAGGTGTCTTCTGTGACATCTTTC
ACXGAGTTAACAGTTGCTGAATCTGGATCAGAAGCTGTGAGAGGAGGTGGGATCGATCTAATTGTCTTGTCACAAAGGGAATGTTATCAT
GTAATTCCAXTAACAAATGGAAAAGAAGATGAGTTTGATCATTCTGCACTCAACTTAAATGATTCTAANCAGTATGAAGGNTCATTTCCT
CACTTCTGTGTCTTCTTCCCACAAACGTTTACCATGAATAATCATGCTTCCATCTGTAGNTATCATGGTAAAAACATGATGTCAACAGAT
GGTGXAAAGGCTGATAAACTAGAACTTACTAAAGCTAAACATACNAGAATAGCTTACACCTTTGNTGTTCTGGATTTTCGTGATCAGTAT
GATCAGCCCTTANTAATTGGTGACAAGACCTTTTTTCCTTTTGGCTCTGTTCATATNGAAGCATCTGCTGATTNCAAACTGGTGGCACTT
GCTGCTCAGATGGTGACAATATGA
Edits in Original Sequence 
GCTTTGGCATCTTAGCTAACACTGAACATTATATTTACATGGTAAAGCTTCTTGGAATGGAAGGACAATTAAGAGAAGCTTATGAACTTG
TTCAGTCACTGCAAGAACCAATT
(5')ATGGTAAAGCTTCTTGGAATGGAAGGACAATTAAGAGAAGCTTATGAACTTGTTCAGTCACTG
CAAGAACCAATTGACTCCGGCATTTGGGGAGCACTATTATCATGCTGTGATGCTCATCGAAATTATGAGTTGGCAGATATTGTAGCTTGT
CGTCTTTTTGGGAATAAGCTAGAGAATAGTAGTTACAGAATTATGCTTTCAAATATGTATGCTAGTGATGGGAGGTGGGATTTGGTAAAT
AAGTTGAGAGTAGATTCTGAGATAACAAAGTTGAAACTTCCTGGAAAAAGCTGGATTACTAGTAAAAAXAACATTCCTTTGAAAGGAACT
CTTGAGGTGTCTTCTGTGACATCTTTCACXGAGTTAACAGTTGCTGAATCTaGGATCAGAAGCTGTGAGAGGAGGTGGGATCGATCTAAT
TGTCTTGTCACAAAGGGAATGTTATCATGTAATTCCAXTAACAAATGGAAAAGAAGATGAGTTTGAcTCATTCTGCACTCAACTTAAATG
ATTCTAANCAGTATGAAGGNTCATTTCCTCACTTCTGTGTCTTCTTCCCACAAACGTTTACCATGAATAATCATGaCTTCCATCTGTAGN
TATCATGGTAAAAACATGATGTCAACAGATGGTGXAAAGGCTGATAAACTAGAACTTACgTAAAGCTAAACATACNAGAATAGCTTACgA
CCTTTGNTGTTCTGGATTTTCGTGATCAGTATGtATCAGCCCTTANTAATTGGTGACAAGACCTTTTTTCCTTTTaGGCTCTGTTCATAT
NGAAGtCATCTGCTGATTNCAAACTGGTGGCACTTGCTGCTCAGATGGTGACAATATGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan