ESTScan Details for Unigene SGN-U341328

Score 
1030
Direction 
Forward
Predicted Peptide Sequence 
MNTAGQVIRCKAAVAWEAGKPLVIEEVDVAPPQKHEVRLKILFTSLCHTDVYFWEAKGQTPLFPRIFGHEAGGIVESVGEGVTDLQPGDH
VLPGLPENVSNAVTVNHQKATCXELLRINTDRGVMISDGQTRFSKDGKPIYHFVGTSTFSEYTVAHSGCVTKIDPQAPLDKVCVLSCGIS
TGLGATLNVAKPTRGSYVAIFGLGAVGLAAAEGARLAGASRIIGIDLNPSRFNDAKKFGVTEFVNPKDHDKPVQEVIAEMTXGGVDRSVE
CTGNVNAMISAFECVHDGWGVAVLXGVPNXDDAFKTHPMKLLNEKTLKGHLLW
Predicted Coding Sequence 
ATGAATACTGCTGGTCAGGTTATTCGCTGCAAAGCTGCGGTTGCATGGGAAGCTGGAAAACCTTTGGTAATTGAAGAAGTGGATGTTGCA
CCTCCACAGAAACATGAAGTTCGTCTCAAGATTCTCTTCACCTCATTGTGCCACACTGATGTTTACTTCTGGGAAGCTAAGGGACAAACA
CCTTTGTTTCCTCGAATTTTCGGACATGAAGCTGGAGGAATTGTGGAGAGTGTAGGTGAAGGTGTTACAGATCTTCAACCAGGAGATCAT
GTTCTTCCTGGTTTACCGGAGAATGTCAGCAATGCCGTCACTGTAAATCATCAGAAAGCAACATGTGXTGAACTCCTAAGAATAAATACA
GACAGGGGAGTTATGATTAGTGATGGTCAAACAAGATTTTCCAAGGATGGAAAGCCGATATACCACTTTGTTGGAACTTCCACTTTTAGT
GAATACACTGTTGCTCATTCTGGTTGCGTCACCAAGATCGATCCACAGGCACCACTTGACAAAGTTTGTGTCCTGAGTTGCGGAATATCA
ACAGGACTTGGTGCGACTCTGAATGTTGCCAAACCTACTAGAGGTTCTTATGTGGCTATTTTTGGTTTGGGAGCTGTTGGCCTTGCTGCT
GCTGAAGGAGCTAGGCTAGCTGGGGCTTCTAGGATCATTGGTATTGATTTGAATCCCAGCAGATTCAATGATGCCAAGAAATTCGGTGTC
ACAGAGTTTGTGAATCCAAAAGATCATGATAAGCCTGTTCAGGAGGTGATCGCTGAGATGACCANTGGAGGTGTTGACCGGAGTGTCGAG
TGTACTGGAAATGTTAACGCTATGATCTCTGCTTTTGAATGTGTTCATGATGGGTGGGGTGTGGCTGTGCTTGNTGGCGTGCCAAACAAX
GACGATGCATTCAAAACTCATCCCATGAAACTGTTGAATGAAAAGACACTCAAGGGCCACCTTCTTTGG
Edits in Original Sequence 
GATCAACAACAATGAATACTGCTGGTCAGGTTATTCGCTGCAAAGCTGCGGTTGCATGGGAAGCTGGAAAAC(5')ATGAATACTGCTGG
TCAGGTTATTCGCTGCAAAGCTGCGGTTGCATGGGAAGCTGGAAAACCTTTGGTAATTGAAGAAGTGGATGTTGCACCTCCACAGAAACA
TGAAGTTCGTCTCAAGATTCTCTTCACCTCATTGTGCCACACTGATGTTTACTTCTGGGAAGCTAAGGGACAAACACCTTTGTTTCCTCG
AATTTTCGGACATGAAGCTGGAGGAATTGTGGAGAGTGTAGGTGAAGGTGTTACAGATCTTCAACCAGGAGATCATGTTCTTCCTGtGTT
TACCGGAGAATGTCAGCAATGCCGTCACTGTAAATCATCAGAAAGCAACATGTGXTGAACTCCTAAGAATAAATACAGACAGGGGAGTTA
TGATTAGTGATGGTCAAACAAGATTTTCCAAGGATGGAAAGCCGATATACCACTTTGTTGGAACTTCCACTTTTAGTGAATACACTGTTG
CTCATTCTGGTTGCGTCACCAAGATCGATCCACAGGCACCACTTGACAAAGTTTGTGTCCTGAGTTGCGGAATATCAACAGGACTTGGTG
CGACTCTGAATGTTGCCAAACCTACTAGAGGTTCTTATGTGGCTATTTTTGGTTTGGGAGCTGTTGGCCTTGCTGCTGCTGAAGGAGCTA
GGCTAGCTGGGGCTTCTAGGATCATTGGTATTGATTTGAATCCCAGCAGATTCAATGATGCCAAGAAATTCGGTGTCACAGAGTTTGTGA
ATCCAAAAGATCATGATAAGCCTGTTCAGGAGGTGATCGCTGAGATGACCANTGGAGGTGTTGACCGGAGTGTCGAGTGTACTGGAAATG
TTAACGCTATGATCTCTGCTTTTGAATGTGTTCATGATGGGTGGGGTGTGGCTGTGCTTGNTGGCGTGCCAAACAAXGACGATGCATTCA
AAACTCATCCCATGAAACTGTTGAATGAAAAGACACTCAAGGGCCACCTTCTTTGG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan