ESTScan Details for Unigene SGN-U341353

Score 
270
Direction 
Forward
Predicted Peptide Sequence 
LENVGAHRGGRRSRTSGSPGLQEFGTRFVTLLGIIIITCQYSWPTTLLLIPLGWLNVWYRGYYLATSRELTRLDSITKAPVIHHFSESIS
CVMTIRCFRKQEMFSQENVNRVDANLRMDFHNNGSNEWLGFRLELLGSLLLCVSAMFMIILPSSIIKPENVGLSISYGLSLNSVLFWSVF
VSCFVENKMVSCERLKQFSCIPSEAEWRKKDFVPPSEWPNHGNVEPEHLQIXYGPILLYA
Predicted Coding Sequence 
XXTTTGGAAAACGTTGGAGCTCACCGAGGTGGCCGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGTTTGTC
ACTCTGCTTGGCATCATCATCATCACATGCCAATATTCTTGGCCAACCACACTACTTTTGATTCCTCTAGGCTGGCTAAATGTTTGGTAC
CGGGGATATTATCTTGCAACATCTCGTGAATTGACTCGGCTTGACTCAATTACAAAAGCACCCGTTATTCATCATTTCTCTGAAAGCATC
TCATGTGTTATGACTATACGCTGCTTTAGGAAGCAGGAGATGTTTAGTCAAGAAAACGTTAACCGAGTTGATGCCAATCTGCGAATGGAT
TTCCACAACAATGGATCCAATGAGTGGTTGGGATTTCGACTGGAACTGCTTGGAAGCTTGCTTCTCTGTGTTTCTGCAATGTTCATGATT
ATCTTACCTAGCAGCATCATCAAGCCAGAGAATGTTGGCTTATCGATATCATATGGTTTGTCCCTTAACAGTGTGCTATTCTGGTCCGTC
TTTGTGAGTTGCTTCGTGGAAAACAAAATGGTTTCTTGTGAAAGATTAAAACAATTCTCATGCATACCATCAGAAGCTGAGTGGCGAAAA
AAGGATTTTGTCCCACCTTCAGAATGGCCGAACCATGGCAATGTTGAGCCTGAACACCTACAAATTANGTATGGTCCAATACTCCTTTAT
GCTTAA
Edits in Original Sequence 
(5')XXTTTGGAAAACGTTGGAGCTCACCGAGGTGGCgCGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGT
TTGTCACTCTGCTTGGCATCATCATCATCACATGCCAATATTCTTGGCCAACCACACTACTTTTGATTCCTCTAGGCTGGCTAAATGTTT
GGTACCGGGGATATTATCTTGCAACATCTCGTGAATTGACTCGGCTTGACTCAATTACAAAAGCACCCGTTATTCATCATTTCTCTGAAA
GCATCTCATGTGTTATGACTATACGCTGCTTTAGGAAGCAGGAGATGTTTAGTCAAGAAAACGTTAACCGAGTTGATGCCAATCTGCGAA
TGGATTTCCACAACAATGGATCCAATGAGTGGTTGGGATTTCGACTGGAACTGCTTGGAAGCTTGCTTCTCTGTGTTTCTGCAATGTTCA
TGATTATCTTACCTAGCAGCATCATCAAGCCAGAGAATGTTGGCTTATCGATATCATATGGTTTGTCCCTTAACAGTGTGCTATTCTGGT
CCGTCTTTGTGAGTTGCTTCGTGGAAAACAAAATGGTTTCTTGTGAAAGATTAAAACAATTCTCATGCATACCATCAGAAGCTGAGTGGC
GAAAAAAGGATTTTGTCCCACCTTCAGAATGGCCGAACCATGGCAATGTTGAGCCTGAACACCTACAAATTANGTATcGGTCCAATACTC
CTTTATGCTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan