ESTScan Details for Unigene SGN-U341393

Score 
25
Direction 
Reverse
Predicted Peptide Sequence 
GSDVXTKYWANVFRSPKKMARSKFVSTTXXLNKAIPKDNFPLPNIKIVIDASKHEMQSFXGLNAGYHQILMDEEDEEKTALITPWGYILY
RVMPLGLKNVGSTYMRAMTTTFHDMIHKEIEVYVDDVINKVPREFGPLDTLEEVFDLLHWYNLKVKSRQNAFGVPAGKLFGFVVSRRGIE
LEPSKIKEIQELPPLKNKKEVMSFLGKLNYISKFISQLTMVCESIFKLLKKDDLTKWTEEFQIAFEANNNYLSNPSMFVPPQEGSPLLLY
LSISDNALDECLPAARGIH
Predicted Coding Sequence 
GGAAGTGACGTANTAACCAAATATTGGGCTAATGTGTTCCGATCGCCAAAAAAGATGGCAAGATCAAAATTTGTGTCAACTACGGXGNAT
CTCAACAAAGCCATCCCTAAGGATAATTTTCCATTGCCGAATATTAAAATTGTGATCGATGCTTCTAAACATGAAATGCAGTCATTTGXT
GGATTAAATGCAGGTTATCATCAGATTCTGATGGACGAAGAAGATGAAGAAAAGACAGCTTTAATTACACCTTGGGGGTATATATTATAC
AGGGTGATGCCACTTGGCCTCAAGAATGTTGGTTCTACCTATATGAGGGCTATGACAACCACATTTCACGATATGATTCATAAGGAGATC
GAGGTGTATGTAGATGACGTCATTAATAAAGTCCCGCGAGAGTTTGGACCACTTGACACACTTGAAGAAGTTTTTGACCTTCTGCATTGG
TATAACTTAAAAGTTAAATCCCGCCAAAATGCCTTTGGAGTTCCTGCCGGTAAATTATTCGGATTTGTAGTCAGCAGAAGGGGCATTGAG
CTTGAACCTTCCAAGATTAAGGAGATTCAAGAGTTACCTCCTCTAAAGAATAAGAAGGAAGTGATGAGTTTCTTGGGCAAGTTAAACTAC
ATCAGTAAATTCATATCCCAATTAACTATGGTGTGTGAGTCTATCTTCAAGTTGTTGAAAAAAGATGATTTGACAAAGTGGACTGAAGAG
TTTCAGATTGCTTTTGAAGCXAATAATAACTATTTGTCCAATCCATCTATGTTTGTACCTCCGCAAGAAGGGAGTCCTTTGTTACTGTAT
TTGTCCATCTCAGATAACGCATTGGATGAGTGCTTGCCTGCAGCCCGGGGGATCCACTAG
Edits in Original Sequence 
(5')GGAAGTGACGTANTAACCgAAATATTGGGCTAATGTGTTCCGATCGCCAAAAAAGATGGCAAGATCAAAATTTGTGTCAACTACGG
XGNATCTCAACAAAGCCATCCCTAAGGATAATTTTCCATTGCCGAATATTAAAATTGTGATCGATaGCTTCTAAACATGAAATGCAGTCA
TTTGXTGGATTAAtATGCAGGTTATCATCAGATTCTGATGGACGAAGAAGATGAAGAAAAGACAGCTTTAATTACACCTTGGGGGTATAT
ATTaATACAGGGTGATGCCACTTGGCCTCAAGAATGTTGGTTCTACCTATATGAGGGCTATGACAACCACATTTCACGATATGATTCATA
AGGAGATCGAGGTGTATGTAGATGACGTCATTAATAAAGTCCCGCGAGAGTTTGGACCACTTGACACACTTGAAGAAGtTTTTTGACCTT
CTGCATTGGTATAACTTAAAAGTTAAATCCCGCCAAAtATGCCTTTGGAGTTCCTGCCGGTAAATTATTCGGATTTGTAGTCAGCAGAAG
GGGCATTGAGCTTGAACCTTCCAAGATTAAGGAGATTCAAGAGTTACCTCCTCTAAAGAATAAGAAGGAAGTGATGAGTTTCTTGGGCAA
GTTAAACTACATCAGTAAATTCATATCCCAATTAACTATGGTGTGTGAGTCTATCTTCAAGTTGTTGAAAAAAGATGATTTGACAAAGTG
GACTGAAGAGTTTCAGATTGCTTTTGAAGCXAATAATAACTATTTGTCCAATCCATCTATGTTTGTACCTCCGCAAGAAGGGAGTCCTTT
GTTACTGTATTTGTCCATCTCAGATAACGCATTcGGATGAGTGCTTGCCTGCAGCCCGGGGGATCCACTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan