ESTScan Details for Unigene SGN-U341404

Score 
301
Direction 
Forward
Predicted Peptide Sequence 
GDPKVADYGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITDKCDVYGFGVLVLEIVTGKKPVEYMEDDVIVLCDMVRGALEEGKV
EECVDKRLHGKFPAEEAIPVMKLGLICTSQVPSNRPNMAEVVXPIGNDQMAFRRPRGTSMISH
Predicted Coding Sequence 
GGTGATCCTAAAGTTGCAGATTATGGGTTAGCAAGGCTGTTACCAATGCTAGACCGATATGTTTTGAGCAGCAAAATTCAAAGTGCACTC
GGTTACATGGCACCTGAATTCGCATGCAAGACTGTGAAGATAACTGATAAGTGCGATGTGTATGGGTTTGGAGTTCTTGTTCTGGAGATA
GTCACTGGAAAGAAACCGGTTGAGTACATGGAAGACGATGTTATTGTATTGTGTGACATGGTAAGGGGTGCATTGGAAGAAGGCAAGGTG
GAAGAGTGTGTTGACAAGAGGCTACATGGAAAATTTCCAGCGGAGGAAGCGATTCCTGTGATGAAGTTGGGTTTAATCTGCACATCACAA
GTCCCTTCAAACAGGCCTAATATGGCAGAAGTGGTTAAXCCTATTGGAAATGATCAGATGGCCTTCAGAAGGCCAAGAGGAACTAGTATG
ATATCCCATTAA
Edits in Original Sequence 
GCTCTGGTGATCCTAAAGTTGCAGATTATGGGTTAGCAAGGCTGTTACCAATGCTAGACCGATATGTTTTGAG(5')GGTGATCCTAAAG
TTGCAGATTATGGGTTAGCAAGGCTGTTACCAATGCTAGACCGATATGTTTTGAGCAGCAAAATTCAAAGTGCACTCGGTTACATGGCAC
CTGAATTCGCATGCAAGACTGTGAAGATAACTGATAAGTGCGATGTGTATGGGTTTGGAGTTCTTGTTCTGGAGATAGTCACTGGAAAGA
AACCGGTTGAGTACATGGAAGACGATGTTATTGTATTGTGTGACATGGTAAGGGGTGCATTGGAAGAAGGCAAGGTGGAAGAGTGTGTTG
ACAAGAGGCTACATGGAAAATTTCCAGCGGAGGAAGCGATTCCTGTGATGAAGTTGGGTTTAATCTGCACATCACAAGTCCCTTCAAACA
GGCCTAATATGGCAGAAGTGGTTAAXCCTATTGGAAATGATCAGATGGCCTTCAGAAGGCCAAGAGGAACTAGTATGATATCCCATTAA
(3')TATGGTGTTCATTTTTTTTTCTCCAATGTTCTTGGTTCTCTGTTCTTCTGGGTTACCGGATTCCTTTTCACCGGGTTTTAGTATGTG
AGGATCTCACTTATCCTTTATTTCAAGTTTATGTAACAACTGATTCTAACATGTAACCTCTTGTGTTTGTTCAAATGAAAGTAAGTTCCA
AAGGTTGATAGTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan