ESTScan Details for Unigene SGN-U341440

Score 
522
Direction 
Forward
Predicted Peptide Sequence 
PESPETLSSRAGLAVVAXGRTDYNFRTNRSGKFLRAASTXELIEPKVLSYFTGSIEKMPKLISKVRASSILQRFSKLNAIRNGGKEAGGY
SQAMRTLTTSNGHVGEPVSRLGQKQIVDALVLGERRRAVSLLYEFSLGNNKLSADDFASILQSCARLPDPLFVMETWKIMEEKEINISDK
CYALAVRALCKGGXLKGGTQFDEYHGRKHKLLFYVANLYNFLAACYETQTIDYANXMYGFDGASDGGGKNEITYAQLLKLAVLQQNLSAV
LEIWKGCRKFYSLSPFLSEEVYMGPSPEPEKSEFRPNQPLQHNGGKLAFYGKLLNLIKNCPGEGFGNLKLGISQPPFFGEMGSFFPIYLA
ETPGINQX
Predicted Coding Sequence 
CCAGAGTCGCCGGAAACACTGTCCTCGCGGGCGGGCCTAGCTGTAGTCGCAGXTGGTCGGACTGATTACAATTTCCGGACTAACCGTTCT
GGAAAATTTCTTCGTGCTGCTAGTACTXATGAACTCATCGAACCGAAAGTTTTAAGTTATTTCACAGGAAGCATTGAGAAGATGCCTAAA
CTTATATCAAAGGTTCGTGCCAGTTCGATATTGCAAAGATTTTCAAAATTAAATGCTATTCGAAATGGAGGAAAGGAAGCTGGAGGCTAC
AGCCAAGCTATGAGAACTCTTACTACCTCAAATGGGCATGTCGGGGAGCCGGTTTCAAGATTAGGGCAAAAACAAATTGTCGATGCACTT
GTCTTGGGAGAGAGAAGAAGAGCTGTTAGTCTCCTGTATGAGTTTAGTCTTGGAAACAACAAATTGAGTGCTGATGATTTTGCTTCTATA
CTGCAAAGTTGTGCAAGACTGCCTGATCCATTATTTGTGATGGAAACTTGGAAGATCATGGAGGAGAAGGAAATCAACATTAGTGACAAG
TGTTATGCTCTTGCCGTTCGAGCACTCTGTAAAGGGGGTXTACTTAAAGGAGGCACTCAGTTTGATGAGTATCATGGCAGAAAACACAAA
TTGTTATTCTATGTTGCCAATTTATACAACTTCCTAGCTGCTTGTTATGAAACACAAACAATAGATTATGCTAATGAXATGTATGGATTT
GATGGAGCATCAGATGGTGGXGGAAAGAATGAGATAACATATGCTCAGCTTCTCAAGCTTGCAGTTTTGCAGCAAAACCTGTCTGCTGTC
CTTGAAATCTGGAAAGGATGTAGAAAATTTTACAGTCTCAGCCCTTTCCTCTCTGAGGAAGTTTATATGGGCCCTTCXCCGGAGCCTGAA
AAATCTGAATTTCGCCCCAACCAGCCCTTACAGCACAATGGTGGAAAATTGGCTTTTTACGGAAAACTTCTTAACTTAATTAAAAATTGC
CCAGGGGAAGGTTTTGGGAATTTAAAATTGGGGATTTCTCAGCCCCCTTTCTTCGGTGAAATGGGGAGTTTTTTTCCAATTTATCTGGCT
GAAACCCCGGGGATTAACCAAAXX
Edits in Original Sequence 
CGTTTAAAGCAAAAAACCAGAGTCGCCGGAAACACTGTCCTCGCGGGCGGGCCTAGCTGTAGTCGCA(5')CCAGAGTCGCCGGAAACAC
TGTCCTCGCGGGCGGGCCTAGCTGTAGTCGCAGXTGGTCGGACTGATTACAATTTCCGGACTAACCGTTCTGGAAAATTTCTTCGTGCTG
CTAGTACTXATGAACTCATCGAACCGAAAGTTTTAAGTTATTTCACAGGAAGCATTGAGAAGATGCCTAAACTTATATCAAAGGTTCGTG
CCAGTTCGATATTGCAAAGATTTTCAAAATTAAATGCTATTCGAAATGGAGGAAAGGAAGCTGGAGGCTACAGCCAAGCTATGAGAACTC
TTACTACCTCAAATGGGCATGTCGGGGAGCCGGTTTCAAGATTAGGGCAAAAACAAATTGTCGATGCACTTGTCTTGGGAGAGAGAAGAA
GAGCTGTTAGTCTCCTGTATGAGTTTAGTCTTGGAAACAACAAATTGAGTGCTGATGATTTTGCTTCTATACTGCAAAGTTGTGCAAGAC
TGCCTGATCCATTATTTGTGATGGAAACTTGGAAGATCATGGAGGAGAAGGAAATCAACATTAGTGACAAGTGTTATGCTCTTGCCGTTC
GAGCACTCTGTAAAGGGGGTXTACTTAAAGGAGGCACTCAGTTTGATGAGTATCATGGCAGAAAACACAAATTGTTATTCTATGTTGCCA
ATTTATaACAACTTCCTAGCTGCTTGTTATGAAACACAAACAATAGATTATGCTAATGAXATGTATGGATTTGATGGAGCATCAGATGGT
GGXGGAAAGAATGAGATAACATATGCTCAGCTTCTCAAGCTTGCAGTTTTGCAGCAAAACCTGTCTGCTGTCCTTGAAATCTGGAAAGGA
TGTAGAAAATTTTACAGTCTCAGCCCTTTCCTCTCTGAGGAAGTTTATATGGGCCCTTCXCCGGAGCCTGAAAAATCTGAATTTCGCCCC
AACCAGCCCTTACAGCACAATGGTGGAAAATTGGCTTTTTACGGAAAACTTCTTAACTTAATTAAAAATTGCCCAGGGGAAGGTTTTGGG
AATTTAAAATTGGGGATTTCTCAGCCCCCTTTcCTTCGGTGAAATGGGGAGTTTTTTTCCAATTTATCTGGCTGAAACCCCGGGGATTAA
CCAAAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan