ESTScan Details for Unigene SGN-U341475

Score 
499
Direction 
Forward
Predicted Peptide Sequence 
MVTLLLVFSFLHWVATTPVSMGFLSPKGVNYEVAALMSMKNKMRDEYHVLDGWDINSVDPCTWYMVGCSSEGFVISLEMASMGLSGTLSP
SIGNLTHLRTMLLQNNHLSGPIPAEIGQLTELLTLDLSGNQFDGGIPRALGRLVYLNYLRLSRNRLSGQIPKPVAYLSSLSFLDLSFNNL
SGPTPKILAQKLQYCKKQISLLCIXPHKFVGGVPKTVNETISDKEDNNHHRGLGSGIGGGNLPNS
Predicted Coding Sequence 
ATGGTAACTTTGCTACTCGTTTTCTCATTTCTTCATTGGGTGGCCACTACTCCAGTTTCCATGGGTTTTCTTTCACCTAAAGGTGTCAAC
TATGAAGTGGCAGCATTGATGTCTATGAAGAATAAAATGAGAGATGAATATCATGTGTTAGATGGATGGGATATAAATTCTGTTGATCCT
TGTACATGGTACATGGTTGGTTGTTCTTCAGAAGGCTTTGTTATTTCTCTTGAAATGGCGAGTATGGGATTATCTGGCACACTTTCGCCT
AGTATTGGGAATTTAACTCATCTTCGGACGATGTTGTTGCAGAATAATCATTTATCTGGTCCGATTCCTGCTGAAATTGGACAGCTCACT
GAACTGCTGACCCTTGATTTGTCTGGTAATCAGTTTGATGGAGGAATTCCTAGGGCGTTGGGTCGCCTGGTTTATTTAAATTACTTGAGG
CTTAGCAGGAACAGATTGTCTGGTCAAATTCCTAAACCTGTGGCATACCTTTCAAGTCTTTCATTCTTGGACTTATCATTCAATAACCTA
AGTGGTCCAACACCTAAAATTTTGGCCCAAAAACTACAGTATTGCAAGAAACAGATTTCTTTGCTTTGCATTGAXCCACACAAATTTGTG
GGGGGTGTGCCCAAAACAGTAAATGAAACAATTTCCGACAAGGAGGATAACAATCATCATCGTGGGTTGGGTTCTGGTATTGGTGGGGGT
AATTTGCCCAATTCT
Edits in Original Sequence 
GCAATGATGAATTCTAAAAAGGACCTTTTTCTGAAAGCTCTGCACCAAAATCTTTCTTTTGGGTAATTAGCTTTTTGGATCCAAATGGTA
ACTTTGCTACTCGTTTTCTCATTTCTTCATTGGGTGGCCACTACTCCAGTTTCCATGGGTTTTCTTTCACCTAAAGGTGTCAACT
(5')A
TGGTAACTTTGCTACTCGTTTTCTCATTTCTTCATTGGGTGGCCACTACTCCAGTTTCCATGGGTTTTCTTTCACCTAAAGGTGTCAACT
ATGAAGTGGCAGCATTGATGTCTATGAAGAATAAAATGAGAGATGAATATCATGTGTTAGATGGATGGGATATAAATTCTGTTGATCCTT
GTACATGGTACATGGTTGGTTGTTCTTCAGAAGGCTTTGTTATTTCTCTTGAAATGGCGAGTATGGGATTATCTGGCACACTTTCGCCTA
GTATTGGGAATTTAACTCATCTTCGGACGATGTTGTTGCAGAATAATCATTTATCTGGTCCGATTCCTGCTGAAATTGGACAGCTCACTG
AACTGCTGACCCTTGATTTGTCTGGTAATCAGTTTGATGGAGGAATTCCTAGGGCGTTGGGTCGCCTGGTTTATTTAAATTACTTGAGGC
TTAGCAGGAACAGATTGTCTGGTCAAATTCCTAAACCTGTGGCATACCTTTCAAGTCTTTCATTCTTGGACTTATCATTCAATAACCTAA
GTGGTCCAACACCTAAAATTTTGGCCCAAAAACTACAGTATTGCAAGAAACAGATTTCTTTGCTTTGCATTGAXCCACACAAATTTGTGG
GGGGTGTGCCCAAAACAGTAAATGAAACAATTTCCGACAAGGAGGATAACAATCAtTCATCGTGGGTTGGGTTCTGGTATTGGTGGGGGT
AATTTGCCCAATTCT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan