ESTScan Details for Unigene SGN-U341480

Score 
-369
Direction 
Forward
Predicted Peptide Sequence 
TIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIAFPTVAQPEGEWQIVAVNILLIPLNFVNKLIXLPIAEIPNPYNSKINQ
KVECGPIWNRVPLKTWPQRKGRKLLKAKGPTGPTL
Predicted Coding Sequence 
ACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGCCTTGCAGCACATCCCCCTTTCG
CCAGCTGGCGTAATAGCGAAAAGGCCCGCACCGATCGCCTTTCCCACAGTTGCGCAGCCTGAAGGCGAATGGCAAATTGTAGCXGTTAAT
ATTTTGTTAATTCCGTTAAATTTTGTTAATAAACTCATTXTTTTACCAATAGCCGAAATCCCAAATCCTTATAATTCAAAGATAAACCAA
AAGGTTGAGTGTGGTCCAATTTGGAACAGAGTCCCTTTAAAAACGTGGCCTCAACGTAAAGGGCGAAAACTGCTTAAGGCGAAGGGCCCT
ACGGGACCTACCCTX
Edits in Original Sequence 
GGTTGCTTAAAATAATATGCCTCTGCAGTTCCTCTGATTACTCCTGTTGATGCCTAAAGATGTTATCAGCTTTGGTTGCTTCTATCACTT
GTATATTCACAATCCTATGCAATCATACTCAACCCTTTGGTCATCTGGAAACCAAAACCCGTGAGATCTGTGTAGTGATTAAGAACAGTC
ATTGGACATGAGGCCAGGTCTCCAGTGTTACCTGAATTAAAATTTCATGCTTGAGCTTCATCGTTCAAGTTACAGCTAAAGAAAATAAAA
TATCCTCCAAGGAGTATCTAGTTGATAGTTAACCATGGGTTTAAAGTTACCAGTTTCAAAAAGAATAGTTAACCATGGGTCTTTTTCTGG
GTTCTCTTACTTCCAGTTCTCTTTTGAATACCTTCTTTATAAGCTATATTAGTATTACTTGTTTCGTGGAATGGTGCAGCTCATGTTATG
CGATTTTGGGTGCAAATAATGAAGTTCATGCTTCTTTGTTTCACT
(5')ACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAA
AACCCTGGCGTTACCCAACTTAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAAAGGCCCGCACCGATCGCCTT
TCCCACAGTTGCGCAGCCTGAAGGCGAATGGCAAATTGTAGCXGTTAATATTTTGTTaAATTCCGTTAAATTTTGTTAATAAACTCATTX
TTTTACCAATAGCCGAAATCgCCAAATCCTTATAATTCAAAGATAAACCAAAAgGGTTGAGTGTGGTCCAATTTGGAACAGAGTCCCTTT
AAAAACGTGGCCTCAACGTAAAGGGCGAAAACTGCTTAAGGCGAAGGGCCCTACGGGACCTACCCTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan