ESTScan Details for Unigene SGN-U341494

Score 
-422
Direction 
Forward
Predicted Peptide Sequence 
MIWRRIHSSPSSEVPYPRERALPVVKIELVSVAVLACGIRSPIGDKFRNEYXVTPIPVLKLTKWNKQSRPGSRLTPPXLRVRNGKGRMSX
DRLEGGPXYPIRPIVSRITIHWPSFYNVVTGKTLALPNXNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWXIVSVNILLKFALIFVK
SAHFLTNRPKIGKSLXNQKNRPEIGLSGVPVGNRVTIKERGLHRQRAKNVYQGEAHYVEHHPNQVFGGXGAVSTKS
Predicted Coding Sequence 
ATGATTTGGAGAAGAATTCATTCCTCTCCGAGCAGTGAAGTGCCATATCCTAGAGAGAGGGCTTTACCGGTCGTTAAGATAGAGTTGGTG
TCGGTAGCTGTTCTTGCTTGCGGGATCAGGTCACCAATCGGTGACAAGTTTAGGAATGAATATXCTGTAACTCCCATTCCAGTACTTAAA
CTGACAAAATGGAATAAACAATCAAGACCTGGCTCAAGGCTAACCCCTCCAXCACTCAGGGTCAGGAACGGGAAAGGGAGAATGAGTAGX
GACAGGCTCGAGGGGGGGCCCGXGTACCCAATTCGCCCTATAGTGAGTCGTATTACAATTCACTGGCCGTCGTTTTACAACGTCGTGACT
GGGAAAACCCTGGCGTTACCCAACTTXAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGAT
CGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCNAATTGTAAGCGTTAATATTTTGTTAAAATTCGCGTTAATTTTTGTTAAA
TCAGCTCATTTTTTAACCAATAGGCCGAAAATCGGCAAATCCCTTATNAATCAAAAGAATAGACCXGAGATAGGGTTGAGTGGTGTTCCA
GTTGGAAACAGAGTCACTATTAAAGAACGGGGACTCCACCGTCAAAGGGCGAAAAACGTCTATCAGGGCGAGGCCCACTACGTTGAACAT
CACCCTAATCAAGTTTTTGGGGGGCNAGGTGCCGTAAGCACTAAATCX
Edits in Original Sequence 
GAGAGATTAGAGGAGATAGCCTTTCTTTCTATTGCTTGAGTGGAATCAGTTGACAAAAAGCTCGAACGTAATTGACTTCTTTCTTAACTT
AAATAAAGGAAGAGATGATTTGGAGAAGAATTCATTCCTCTCCGAGCAGTGAAGTGCCATATCCTAGAGAGAGGGCTTTACCGGTCGT
(5')
ATGATTTGGAGAAGAATTCATTCCTCTCCGAGCAGTGAAGTGCCATATCCTAGAGAGAGGGCTTTACCGGTCGTTAAGATAGAGTTGG
TGTCGGTAGCTGTTCTTGCTTaGCGGGATCAGGTCACCAATCGGTGACAtAGTTTAGGAATGAATATXCTGTAACTCCCATTCCAGTACT
TAAACTGACAAAATGGAATAAACAATCAAGACCTGGCTCAAGGCTAACCCCTCCAXCACTCAGGGTCAGGAACGGGAAAGGGAGAATGAG
TAGXGACAGGCTCGAGGGGGGGCCCGXGTACCCAATTCGCCCTATAGTGAGTCGTATTACAATTCACTGGCCGTCGTTTTACAACGTCGT
GACTGGGAAAACCCTGGCGTTACCCAACTTXAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCAC
CGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCNAATTGTAAGCGTTAATATTTTGTTAAAATTCGCGTTaAATTTTTG
TTAAATCAGCTCATTTTTTAACCAATAGGCCGAAAATCGGCAAATCCCTTATNAATCAAAAGAATAGACCXGAGATAGGGTTGAGTGGTG
TTCCAGtTTGGAAACAGAGTCACTATTAAAGAACGGGGACTCCACCGTCAAAGGGCGAAAAACGTCTATCAGGGCGAGGCCCACTACGTT
GAACATCACCCTAATCAAGTTTTTGGGGGGCNAGGTGCCGTAAGCACTAAATCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan