Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U341542

Score 
481
Direction 
Forward
Predicted Peptide Sequence 
MALLQIDLKLYAGLSIAEKLLTNRDLVGSKSFATRARESDPSLAHPIDQILSIVDTLTAGDKRINNHHFDYYSILQIPPNQTQNFEFIAD
QYRRFALLLNPQNNNFPFSDQAFGLVVDAFSVLSDPLEKVCMIKNWAFFLNLYPVASAPTPVSFVQHGGFNQMQGSTADQLFVNMPSQDQ
GSHATGEAIVEIRKLEILAGYISETVSRDYDYGELRXQAEHPAQQQQQQQXXTPVTSLRQQTQQRVEFSFRFQHRMTAATILDLTKPRXX
Predicted Coding Sequence 
ATGGCCCTCCTACAAATCGATCTGAAGCTTTACGCTGGXCTATCAATCGCCGAGAAGCTGTTAACGAATCGTGATCTTGTTGGTAGTAAA
TCATTTGCAACTCGTGCCCGTGAATCCGACCCGTCTTTAGCTCACCCAATCGATCAAATCCTCAGCATCGTCGATACCCTCACCGCCGGT
GATAAACGTATCAACAATCATCACTTTGATTACTACTCTATCCTTCAGATCCCTCCTAACCAAACCCAGAACTTCGAATTCATCGCCGAT
CAGTATCGTCGATTTGCTCTTCTTTTGAATCCCCAAAACAATAACTTTCCGTTTTCGGATCAAGCTTTTGGGCTTGTGGTTGATGCGTTT
TCAGTTCTTTCTGATCCTTTGGAAAAAGTATGTATGATAAAGAATTGGGCTTTTTTTCTGAATCTTTACCCAGTTGCTTCTGCACCTACA
CCGGTGAGTTTTGTGCAGCATGGTGGGTTTAATCAAATGCAGGGGTCGACTGCAGACCAGCTGTTTGTGAATATGCCTAGTCAAGATCAA
GGTTCACATGCTACTGGAGAAGCTATAGTAGAGATCCGCAAGCTGGAAATTCTTGCCGGGTACATTTCTGAAACCGTGAGCAGAGACTAT
GACTATGGGGAGCTCAGGNNTCAAGCAGAGCACCCAGCACAACAGCAGCAGCAGCAACAACANNNCACACCTGTAACATCTCTGAGACAA
CAAACACAACAACGGGTGGAGTTCTCCTTTCGTTTTCAACATAGAATGACAGCTGCTACCATTCTTGATTTAACCAAACCACGGNCGTXX
Edits in Original Sequence 
GGGAACATCCATTCTTCATCAATGGCCCTCCTACAAATCGATCTGAAGCTTTACGCTGGCTATCAATCGCCGAGAAGCTGTTAACGAATC
GTGATC
(5')ATGGCCCTCCTACAAATCGATCTGAAGCTTTACGCTGGXCTATCAATCGCCGAGAAGCTGTTAACGAATCGTGATCTTGT
TGGTAGTAAATCATTTGCAACTCGTGCCCGTGAATCCGACCCGTCTTTAGCTCACCCAATCGATCAAATCCTCAGCATCGTCGATACCCT
CACCGCCGGTGATAAACGTATCAACAATCATCACTTTGATTACTACTCTATCCTTCAGATCCCTCCTAACCAAACCCAGAACTTCGAATT
CATCGCCGATCAGTATCGTCGATTTGCTCTTCTTTTGAATCCCCAAAACAATAACTTTCCGTTTTCGGATCAAGCTTTTGGGCTTGTGGT
TGATGCGTTTTCAGTTCTTTCTGATCCTTTGaGAAAAAGTATGTATGATAAAGAATTGGGCTTTTTTTCTGAATCTTTACCCAGTTGCTT
CTGCACCTACACCGGTGAGTTTTGTGCAGCATGGTGGGTTTAATCAAATGCAGGGGTCGACTGCAGACCAGCTGTTTGTGAATATGCCTA
GTCAAGATCAAGGTTCACATGCTACTGGAGtAAGCTATAGTAGAGATCCGCAAGCTGGAAATTCTaTGCCGGGTACATTTCTGAAACCGT
GAGCAGAGACTATGACTATGGGGAGCTCAGGNNTCAgAGCAGAGCACCCAGCACAACAGCAGCAGCAGCAACAACANNNCACACCTGTAA
CATCTCTGAGACAACAAACACAACAACGGGTGGAGTTCTCCTTTCGTTTTCAACATAGAATGACAGcCTGCTACCATTCTTGATTTAACC
AAACCACGGNCGTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan