ESTScan Details for Unigene SGN-U341583

Score 
540
Direction 
Reverse
Predicted Peptide Sequence 
RLGAKVKILQRGCFGFTNYQEGYDQLWAIETLGLVMATDGSLNGRFXDFGLAGLYEHGSNPGRNRVVGTWGYLHPELPGTGRATEKSDVF
AFGALLLEVVCGRRPIDSKVGPEELVLVDMVWNKWREGKILDVIDKRLKGEFNESEVVMVLKLGLMCSNNEASSRPSMRQVMSYLEGEAD
IPDAPMAPGDYNGGFGFEENECMHSLASSRGHTSCLANGNVDGTFVSVSTAPLSCLFTDELPR
Predicted Coding Sequence 
AGACTGGGAGCAAAGGTTAAAATTCTTCAAAGGGGTTGTTTCGGGTTTACAAACTACCAGGAAGGTTATGACCAGTTGTGGGCCATCGAG
ACTTTAGGCTTAGTAATGGCTACTGATGGAAGTTTAAATGGCAGGTTTGAXGATTTTGGCCTAGCAGGATTATATGAGCACGGATCAAAC
CCGGGCAGGAATAGGGTGGTAGGCACATGGGGGTACTTGCACCCGGAATTACCAGGAACAGGACGAGCTACTGAAAAATCCGATGTTTTT
GCCTTTGGTGCGTTGTTGCTTGAAGTGGTATGTGGACGTAGACCGATTGATTCAAAGGTGGGGCCAGAGGAATTAGTTCTAGTAGACATG
GTGTGGAACAAATGGAGAGAGGGGAAAATTCTTGATGTTATAGACAAGAGATTGAAAGGTGAGTTCAATGAAAGTGAAGTTGTGATGGTG
TTGAAATTAGGACTAATGTGTTCAAACAATGAGGCGTCGTCTCGACCTAGCATGAGACAAGTGATGAGTTACTTGGAAGGTGAAGCTGAT
ATACCTGATGCTCCAATGGCTCCTGGTGATTATAATGGAGGATTTGGATTCGAAGAAAACGAATGTATGCATTCTTTAGCATCTTCAAGA
GGACATACATCATGTTTGGCTAATGGAAATGTTGATGGTACATTTGTTTCTGTTTCTACTGCACCACTTTCATGTTTATTTACTGATGAG
TTGCCTAGGTAGTGA
Edits in Original Sequence 
(5')AGACTGGGAGCAAAGGTTAAAATTCTTCAAAGGGGTTGTTTCGGGTTTACAAACTACCAGGAAGGTTATGACCAGTTGTGGGCCAT
CGAGACTTTAGGCTTAGTAATGGCTACTaGATGGAAGTTTAAATGGCAGGTTTGAXGATTTTGGCCTAGCAGGATTATATGAGCACGGAT
CAAACCCGGGCAGGAATAGGGTGGTAGGCACATGGGGGTACTTGCACCCGGAATTACCAGGAACAGGACGAGCTACTGAAAAATCCGATG
TTTTTGCCTTTGGTGCGTTGTTGCTTGAAGTGGTATGTGGACGTAGACCGATTGATTCAAAGGTGGGGCCAGAGGAATTAGTTCTAGTAG
ACATGGTGTGGAACAAATGGAGAGAGGGGAAAATTCTTGATGTTATAGACAAGAGATTGAAAGGTGAGTTCAATGAAAGTGAAGTTGTGA
TGGTGTTGAAATTAGGACTAATGTGTTCAAACAATGAGGCGTCGTCTCGACCTAGCATGAGACAAGTGATGAGTTACTTGGAAGGTGAAG
CTGATATACCTGATGCTCCAATGGCTCCTGGTGATTATAATGGAGGATTTGGATTCGAAGAAAACGAATGTATGCATTCTTTAGCATCTT
CAAGAGGACATACATCATGTTTGGCTAATGGAAATGTTGATGGTACATTTGTTTCTGTTTCTACTGCACCACTTTCATGTTTATTTACTG
ATGAGTTGCCTAGGTAGTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan