ESTScan Details for Unigene SGN-U341600

Score 
518
Direction 
Forward
Predicted Peptide Sequence 
EEHHAVAAAXRTSGSPGLQADIEYDDTYIDNANFGHDAKCGSMREAKLIFDMMNFKDVASWNIMIKGYGMHGFGIKALELFSDMCKAELR
PDDVTFVGVLSACSPSGLVKQGREFLAHMQPKYGVVPSIEHYTSVIDMLCRAGQLEAAYELLLTMPIKTNSVVWRAFLAACRIHGNDDLA
KGAAKQVLDLEPDHCGSYVILSNVYGQTGRYEEVLEIRDAMKLPNVRKTPVVAGLNFHNGVHVFITADKSHPETNPIYALDEFFNHPACV
SLVIHPKLIPWKTVPYIPNLFFHCX
Predicted Coding Sequence 
GAGGAGCACCACGCGGTGGCGGCCGCTXCTAGAACTAGTGGATCCCCCGGGCTGCAGGCTGACATAGAATATGATGATACTTACATTGAC
AATGCCAATTTTGGACATGATGCCAAATGTGGAAGCATGCGTGAAGCTAAGCTGATCTTTGATATGATGAATTTCAAAGATGTGGCATCG
TGGAACATTATGATTAAGGGGTATGGCATGCATGGATTTGGCATCAAAGCATTAGAATTGTTTTCTGATATGTGTAAGGCAGAATTGAGG
CCTGATGATGTCACATTTGTTGGGGTTTTGTCAGCTTGCAGCCCTTCAGGGCTTGTAAAACAGGGGAGAGAATTTCTTGCCCACATGCAG
CCTAAATATGGTGTTGTGCCTTCTATTGAACATTACACCTCTGTGATTGACATGCTATGTCGTGCTGGGCAGCTTGAAGCTGCTTATGAG
TTGTTATTAACAATGCCCATTAAGACCAATTCCGTCGTATGGAGAGCGTTCTTGGCTGCCTGCCGTATACATGGTAATGATGATCTTGCT
AAGGGTGCTGCAAAACAGGTACTTGATCTTGAACCAGATCATTGTGGAAGTTATGTCATATTATCAAATGTTTATGGACAGACTGGTCGC
TATGAAGAGGTATTAGAGATAAGAGATGCTATGAAGCTCCCAAATGTTAGGAAGACACCTGTTGTAGCTGGATTGAACTTCCATAATGGT
GTCCATGTCTTTATTACTGCTGATAAATCACATCCCGAAACCAACCCTATTTATGCXCTGGATGAATTCTTTAACCACCCCGCATGTGTG
AGCCTTGTTATACACCCCAAATTGATTCCCTGGAAAACAGTCCCTTATATTCCCAACTTATTCTTCCATTGTCXX
Edits in Original Sequence 
CTGACATAGAATATGATGATACTTA(5')GAGGAGCACCACGCGGTGGCGGCCGCTXCTAGAACTAGTGGATCCCCCGGGCTGCAGGCTG
ACATAGAATATGATGATACTTACATTGACAATGCCAATTTTGGACATGtATGCCAAATGTGGAAGCATGCGTGAAGCTAAGCTGATCTTT
GATATGATGAATTTCAAAGATGTGGCATCGTGGAACATTATGATTAAGGGGTATGGCATGCATGGATTTGGCATCAAAGCATTAGAATTG
TTTTCTGATATGTGTAAGGCAGAATTGAGGCCTGATGATGTCACATTTGTTGGGGTTTTGTCAGCTTGCAGCCCTTCAGGGCTTGTAAAA
CAGGGGAGAGAATTTCTTGCCCACATGCAGCCTAAATATGGTGTTGTGCCTTCTATTGAACATTACACCTCTGTGATTGACATGCTATGT
CGTGCTGGGCAGCTTGAAGCTGCTTATGAGTTGTTATTAACAATGCCCATTAAGACCAATTCCGTCGTATGGAGAGCGTTCTTGGCTGCC
TGCCGTATACATGGTAATGATGATCTTGCTAAGGGTGCTGCAAAACAGGTACTTGATCTTGAACCAGATCATTGTGGAAGTTATGTCATA
TTATCAAATGTTTATGGACAGACTGGTCGCTATGAAGAGGTATTAGAGATAAGAGATGCTATGAAGCTCCCAAATGTTAGGAAGACACCT
cGTTGTAGCTGGATTGAACTTCCATAATGGTGTCCATGTCTTTATTACTGCTGATAAATCACATCCCGAAACCAACCCTATTTATGCXCT
GGATGAATTCTTTAACCACCCCGCATGTGTGAGCCTTGTTATACACCCCAAATTGATTCCCTGGAAAACAGTCCCTTATATTCCCAACTT
ATTCTTCCATTGTCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan