ESTScan Details for Unigene SGN-U341662

Score 
636
Direction 
Forward
Predicted Peptide Sequence 
MPXSDTIGTFVKWRGPPVELLSKLKQERSFLENNESSLALDELEIMFKALEKSKCIDRVVFDLSLARGLDYYTGVIFEAVFKGAAQVGSI
AAGGRYDNLIGMFGTRQVPSVGISLGIERVFAILEQLQKDKNQEIRATETPSSRYHSGDDSALAADLLGEFGXLLKVTAEFWIPKKVVNP
FDRPRKSKDPLNGPLLGNPNFSGRNLKI
Predicted Coding Sequence 
ATGCCCTTXTCAGACACAATTGGTACATTTGTCAAATGGAGGGGACCTCCAGTGGAATTATTATCTAAGCTCAAGCAAGAACGTAGTTTT
CTGGAGAACAATGAATCTTCACTTGCTTTGGATGAATTAGAGATTATGTTTAAAGCTCTGGAGAAGTCCAAGTGTATTGACAGAGTGGTT
TTTGACTTGAGCCTTGCAAGAGGCCTTGATTACTACACAGGAGTCATATTTGAAGCAGTCTTCAAAGGAGCTGCTCAGGTTGGTTCGATT
GCTGCTGGTGGACGTTATGACAACCTGATAGGGATGTTTGGGACACGGCAGGTTCCTTCTGTTGGGATCAGTCTGGGAATAGAGAGAGTA
TTTGCAATCTTGGAACAGCTTCAGAAAGACAAAAATCAGGAAATTCGAGCCACTGAAACTCCAAGTTCTCGTTACCATTCTGGTGATGAC
AGCGCTTTGGCTGCTGACCTACTTGGTGAATTTGGGGAXCTGCTAAAAGTGACAGCAGAATTCTGGATCCCTAAAAAAGTGGTGAACCCC
TTTGATCGGCCCAGAAAATCCAAGGACCCCTTGAATGGCCCTTTGTTGGGGAACCCCAATTTTAGTGGAAGGAATCTTAAAATCTAA
Edits in Original Sequence 
ATTGGTACATTTGTCAAATGGAGGGGACCTCCAGTGGAATTA(5')ATGCCCTTXTCAGACACAATTGGTACATTTGTCAAATGGAGGGG
ACCTCCAGTGGAATTATTATCTAAGCTCAAGCAAGAACGTAGTTTTCTGGAGAACAATGAATCTTCACTTGCTTTGGATGAATTAGAGAT
TATGTTTAAAGCTCTGGAGAAGTCCAAGTGTATTGACAGAGTGGTTTTTGACTTGAGCCTTGCAAGAGGCCTTGATTACTACACAGGAGT
CATATTTGAAGCAGTCTTCAAAGGAGCTGCTCAGGTTGGTTCGATTGCTGCTGGTGGACGTTATGACAACCTGATAGGGATGTTTGGGAC
ACGGCAGGTTCCTTCTGTTGGGATCAGTCTGGGAATAGAGAGAGTATTTGCAATCTTGGAACAGCTTCAGAAAGACAAAAATCAGGAAAT
TCGAGCCACTGAAACTCCAAGTTCTCGTTACCATTCTgGGTGATGACAGCGCTTTGGCTGCTGACCTACTTGGTGAATTTGGGGAXCTGC
TAAAAGTGACAGCAGAATTCTGGATCCCTAAAAAAGTGGTGAACCCCTTTGATCGGCCCAGAAAATCCAAGGACCCCTTGAATGGCCCTT
TGTTGGGGAACCCCAATTTTAGTGGAAGGAATCTTAAAATCTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan