ESTScan Details for Unigene SGN-U341683

Score 
244
Direction 
Reverse
Predicted Peptide Sequence 
TYTILVDCYALPXKVDDALHYLRELKSAGLDPDLISYNLMINGLGKSGKMKEALHLLNEMKSRGITPNLYTYNTLIFNLGIVGMLEEAGR
MYEELQQLGLEPDVFTYNALIRGYSKSGDPDGAYAIYEKMMVGGCSPNSGTFAQLPXLTADILGSSSEACESEFLNSAVGAAKGLPLLIG
RYYLELVDVQQGSWGGAEPQSLSDFILRCSINPNTLSI
Predicted Coding Sequence 
XXGACGTACACCATTCTTGTAGATTGTTATGCTCTGCCAGXGAAGGTGGACGATGCTTTGCACTACTTGAGGGAACTGAAATCAGCTGGT
CTTGATCCTGATTTGATTTCTTACAACCTTATGATCAACGGTCTTGGGAAATCTGGTAAAATGAAGGAAGCGCTGCATCTTCTTAATGAG
ATGAAAAGCAGAGGAATCACCCCGAATCTTTATACCTATAATACCTTGATATTCAATCTTGGGATTGTTGGAATGTTGGAGGAGGCCGGA
AGGATGTATGAAGAACTTCAGCAACTCGGTCTTGAACCCGATGTTTTTACTTATAATGCTCTTATTAGGGGGTACAGCAAGTCTGGTGAT
CCAGATGGTGCATATGCCATTTATGAGAAAATGATGGTCGGGGGTTGTAGCCCAAATAGTGGTACTTTTGCTCAACTACCTAXATTAACA
GCGGACATTTTAGGTTCTTCAAGTGAAGCTTGTGAGAGCGAGTTCCTAAACTCTGCXGTTGGGGCTGCTAAGGGGTTACCTCTGCTGATT
GGACGTTACTATTTGGAGCTTGTAGATGTGCAGCAAGGTTCTTGGGGCGGGGCTGAACCTCAAAGTCTTTCGGATTTCATTTTAAGGTGC
TCTATAAATCCGAATACGTTGTCTATATAA
Edits in Original Sequence 
(5')XXGACGTACACCATTCTTGTAGATTGTTATGCTCTGCCAGXGAAGGTGGACGATGCTTTGCACTACTTGAGGGAACTGAAATCAGC
TGGTCTTGATCCTGATTTGATTTCTTACAACCTTATGATCAACGGTCTTGGGAAATCTGGTAAAATGAAGGAAGCGCTGCATCTTCTTAA
TGAGATGAAAAGCAGAGGAATCACCCCGAATCTTTATACCTATAATACCTTGATATTCAATCTTGGGATTGTTGGAATGTTGGAGGAGGC
CGGAAGGATGTATGAAGAACTTCAGCAACTCGGTCTTGAACCCGATGTTTTTACTTATAATGCTCTTATTAGGGGGTACAGCAAGTCTGG
TGATCCAGATGGTGCATATGCCATTTATGAGAAAATGATGGTCGGGGGTTGTAGCCCAAATAGTGGTACTTTTGCTCAACTACCTAXATT
AACAGCGGACATTTTAGGTTCTTCAAGTGAAGCTTGTGAGAGCGAGTTCCTAAACTCTGCXGTTGGGGCTGCTAAGGGGTTACCTCTGCT
GATTGGACGTTACTATTTGGAGCTTGTAGATGTGtCAGCAAGGTTCTTGGGGCGGGGCTGAACCTCAAAGTCTTTCGGATTTCATTTTAA
GGTGCTCTATAAATCCGAATACGTTGTCTATATAA(3')AAGAATGAGTGGGCAGTCTTAGCATTAAGTGTAGCATATCTCTTATGCTTG
GTGAATACATGGTGCCTATATCTGTAGATAATTCAACCATATTTGAGGCAAAACTCTTTATAAAGTTTTGATTTGTTATTCAATTTACTA
AGAAATGTAGTGATCTTCTTGTTGCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan