ESTScan Details for Unigene SGN-U341694

Score 
-350
Direction 
Reverse
Predicted Peptide Sequence 
WGSGPFGGPLAQGFFRGYPPDLGENPISPFEGGDTVGRSGTPEGRDLLSEEAEEPPIRKPPFPGGGGFFNAVGPKGFPPGKGAGGATQLR
GVGSFFGPPRVYPLCFRLVFGGELGGDNNFPRETVLPRIPPSWKLPLPKGKKRGGSPGGGGRFRIRGSPGVREFAGGLVRNWAGGGIKFQ
KSKGGFLPLIKAGLDIVVGVGLFQWAPKKVLPRETGPFGFVGPLISGYQLFPAPPKAKTWGKALMGGRNSRFPW
Predicted Coding Sequence 
TGGGGTTCGGGGCCTTTTGGGGGGCCTTTGGCTCAAGGTTTTTTTCGGGGGTATCCCCCCGATTTGGGGGAAAACCCTATTTCCCCCTTT
GAGGGAGGGGATACCGTTGGCCGCAGCGGAACGCCCGAGGGCAGGGATTTATTGAGCGAGGAAGCGGAAGAGCCCCCAATACGCAAACCC
CCTTTCCCGGGGGGTGGCGGTTTCTTTAATGCAGTGGGCCCGAAAGGTTTTCCGCCTGGAAAGGGGGCAGGGGGGGCAACGCAATTAAGG
GGGGTTGGCTCCTTCTTTGGGCCCCCCCGGGTTTACCCTTTATGTTTCCGGTTGGTTTTTGGTGGGGAATTGGGGGGGGATAACAATTTC
CCCCGGGAAACAGTTTTGCCCAGGATTCCGCCAAGCTGGAAATTACCCCTCCCTAAAGGGAAAAAAAGGGGGGGTTCCCCCGGGGGXGGG
GGCCGTTTTAGAATTAGGGGTTCCCCCGGGGTGCGGGAATTTGCCGGGGGCCTTGTTCGGAATTGGGCCGGGGGCGGGATTAAGTTTCAG
AAGTCAAAAGGGGGGTTTTTACCCCTGATTAAAGCGGGCCTTGATATAGTAGTTGGTGTGGGATTGTTCCAATGGGCCCCTAAGAAAGTC
CTTCCCCGGGAAACGGGGCCCTTTGGATTTGTTGGCCCCTTGATATCAGGTTATCAGTTGTTCCCAGCCCCCCCAAAGGCCAAGACATGG
GGAAAGGCTTTAATGGGGGGGAGGAATTCCCGGTTTCCCTGG
Edits in Original Sequence 
CGGGGGCCTTGTTCGGAATTGGGCCGGGGGCGGGATTAAGTTTCAGAAGTCAAAAGGGGGGTTTTTACCCCTGATTAAAGCGGGCCTTGA
TATAGTAGTTGGTGTGGGATTGTTCCAATGGGCCCCTAAGAAAGTCCTTCCCCGGGAAACGGGGCCCTTTGGATTTGTTGGCCCCTTGAT
ATCAGGTTATCAGTTGTTCCCAGCCCCCCCAAAGGCCAAGACATGGGGAAAGGCT
(5')TGGGGTTCGGGGCCTTTTGGGGGGCCTTTGG
CTCAAGGTTTTTTTCGGGGGTATCCCCCCGATTTGGGGGAAAACCCgTATTTCCCCCTTTGAGGGAGGGGATACCGTTGGCCGCAGCGGA
ACGCCCGAGGGCAGGGATTTATTGAGCGAGGAAGCGGAAGAGCCCCCAATACGCAAACCCCCTTTCCCGGGGGGTgGGCGGTTTCTTTAA
TGCAGTGGGCCCGAAAGGTTTTCCGCCTGGAAAGGGGGCAGGGGGGGCAACGCAATTAAGGGGGGTTGGCTCCTTCTTTGGGCCCCCCCG
GGTTTACCCTTTATGTTTCCGGTTGGTTTTTGGTGGGGAATTGGGGGGGGATAACAATTTCCCCCGGGAAACAGTTTTGCCCAGGATTCC
GCCAAGCTGGAAATTACCCCTCCCTAAAGGGAAAAAAAGGGGGGGTTCCCCCGGGGGXGGGGGCCGTTTTAGAATTAGGGGTTCCCCCGG
GGTGCGGGAATTTgGCCGGGGGCCTTGTTCGGAATTGGGCCGGGGGCGGGATTAAGTTTCAGAAGTCAAAAGGGGGGTTTTTACCCCTGA
TTAAAGCGGGCCTTGATATAGTAGTTGGTGTGGGATTGTTCCAATGGGCCCCTAAGAAAGTCCTTCCCCGGGAAACGGGGCCCTTTGGAT
TTGTTGGCCCCTTGATATCAGGTTATCAGTTGTTCCCAGCCCCCCCAAAGGCCAAGACATGGGGAAAGGCTTTAATGGGGGGGAGGAATT
CCCGGTTTCCCTGG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan