Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U341708

Score 
-324
Direction 
Reverse
Predicted Peptide Sequence 
PDRRFSPLDVEVHVLNSGLCSQTGQPLTPYLGXILLIXKGFCRFRLIGKKMADLTKFNANFKQNINAYNLPFAIQAAQLLGRAIGAGLFA
ITPAGERGMCCKAIKLGNARVFPVTTVVKRRPVNCNTTHYRANWVPGP
Predicted Coding Sequence 
XNCCCTGATAGACGGTTTTCGCCCCTTGACGTTGAAGTCCACGTTCTTAATAGTGGACTCTGTTCCCAAACTGGACAACCACTCACCCCT
TATCTCGGTXCTATTCTTTTGATTNATAAGGGATTTTGCCGATTTCGGCTTATTGGTAAAAAAATGGCTGATTTAACAAAATTTAACGCG
AATTTTAAACAAAATATTAACGCTTACAATTTGCCATTCGCCATTCAGGCTGCGCAACTGTTGGGAAGGGCGATCGGTGCGGGCCTCTTC
GCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACXGTTGTAAAA
CGACGGCCAGTGAATTGTAATACGACTCACTATAGGGCGAATTGGGTACCGGGCCCC
Edits in Original Sequence 
(5')XNCCCTGATAGACGGTTTTCGCCCCTTGACGTTGAAGTCCACGTTCTTAATAGTGGACTCTGTTCCCAAACTGGACAACCACTCAC
CCCTTATCTCGGTXCTATTCTTTTGATTNATAAGGGATTTTGCCGATTTCGGCTTATTGGTAAAAAAATGaGCTGATTTAACaAAAATTT
AACGCGAATTTTAAACAAAATATTAACGCTTACAATTTGCCATTCGCCATTCAGGCTGCGCAACTGTTGGGAAGGGCGATCGGTGCGGGC
CTCTTCGCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACXGTT
GTAAAACGACGGCCAGTGAATTGTAATACGACTCACTATAGGGCGAATTGGGTACCGGGCCCC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan