ESTScan Details for Unigene SGN-U341725

Score 
410
Direction 
Forward
Predicted Peptide Sequence 
FLRTESAGXTXTTAGAPPFGGRPRTXGSPGLFEFGTVDGALVGLPGVDGLSTDQRKRLTIAVELVANPSIVFMDEPTSGLDARSAAIVMR
TVRNIVDTGRTIVCTIHQPSIDIFESFDELLLMKRGGQLIYAGSLGNRSCKLIQYFEEIQGVHRIRSGQNPAAWVLEVTSSAEENRLGVD
FADIYRKSTLFQQNEEMVESLSKPQEGSSELYFSSKFF
Predicted Coding Sequence 
XXGTTTTTAAGAACTGAATCCGCTGGXANAACTAGNACAACTGCTGGNGCTCCACCGTTTGGCGGNCGCCCTAGAACTAGNGGATCCCCC
GGGCTGTTTGAATTCGGCACXGTTGATGGAGCTTTAGTTGGCCTACCTGGAGTAGATGGATTGTCAACAGATCAAAGGAAAAGGTTGACG
ATTGCAGTTGAGCTTGTAGCCAATCCTTCAATAGTTTTTATGGATGAACCTACTTCAGGACTAGATGCGCGGTCTGCAGCCATTGTAATG
AGAACAGTGAGAAACATTGTCGACACTGGAAGAACAATCGTCTGCACCATCCATCAGCCTAGTATAGATATCTTTGAATCATTTGACGAG
CTTTTGCTCATGAAAAGAGGTGGACAGCTCATTTATGCTGGTTCACTAGGGAACAGATCATGCAAACTTATTCAGTATTTTGAGGAAATT
CAAGGAGTTCACAGAATTAGGTCTGGACAGAACCCTGCTGCTTGGGTTCTTGAAGTTACTTCTTCAGCAGAAGAAAATCGCCTCGGTGTA
GATTTTGCTGACATTTATCGAAAATCGACTTTATTCCAGCAAAATGAGGAAATGGTTGAAAGTTTAAGCAAACCACAAGAAGGTTCATCT
GAGCTATATTTCTCAAGCAAGTTCTTTTAG
Edits in Original Sequence 
(5')XXGTTTTTAAGAACTGAATCCGCTGGXANAACTAGNACAACTGCTGGNGCTCCACCGTTTGGCGGNCGCCCTAGAACTAGNGGATC
CCCCGGGCTGTTTGAATTCGGCACXGTTGATGGAGCTTTAGTTGGCCTACCTGGAGTAGATGGATTGTCAACAGATCAAAGGAAAAGGTT
GACGATTGCAGTTGAGCTTGTAGCCAATCCTTCAATAGTTTTTATGGATGAACCTACTTCAGGACTAGATGCGCGGTCTGCAGCCATTGT
AATGAGAACAGTGAGAAACATTGTCGACACTGGAAGAACAATCGTCTGCACCATCCATCAGCCTAGTATAGATATCTTTGAATCATTTGA
CGAGCTTTTGCTCATGAAAAGAGGTGGACAGCTCATTTATGCTGGTTCACTAGGGAACAGATCATGCAAACTTATTCAGTATTTTGAGGA
AATTCAAGGAGTTCACAGAATTAGGTCTGGACAGAACCCTGCTGCTTGGGTTCTTGAAGTTACTTCTTCAGCAGAAGAAAATCGCCTCGG
TGTAGATTTTGCTGACATTTATCGAAAATCGACTTTATTCCAGCAAAATGAGGAAATGGTTGAAAGTTTAAGCAAACCACAAGAAGGTTC
ATCTGAGCTATATTTCTCAAGCAAGTTCTTTTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan