ESTScan Details for Unigene SGN-U341747

Score 
368
Direction 
Forward
Predicted Peptide Sequence 
IPRGSAHNSGSPGLQELARPSITDVLLERGEITADEIWSIYKSSPKSPQPTVSPIDEYGSLIYAGRWGVHGVSLPGRVTFAPGNVGFATF
GAPRPMETQIVSDETWKLIDGIWDKRVEEMKAAVSLETEEDEEKPKLLMASHFHRFNFQVSDTGRMLHSSIIVCSRYKDPNTHYSDKHFD
ISSIFQVFLRSELDSRYARGLDGDKLYDDASLKHYPLMTALGNAELKINIPSTTRKRCSTGANXPILDDGLQLTRCPFSPNQLINFPWGP
QQVFGRCPITENFVNYSPTPAPNPPFPYPLKAPSPTFGIILENSTSLCFKILVSGVVILTTPLGPKYIFWGTLKLFLKKKKKKTSEGGPR
QPNFPLIWTAHNKTAPHPSPLPYTAPTPHSTPSSISPPPTTPP
Predicted Coding Sequence 
XXAATCCCGCGTGGCTCCGCTCACAATAGTGGATCCCCCGGGCTGCAGGAATTGGCACGCCCTTCAATTACAGATGTGTTACTTGAGAGA
GGAGAGATCACAGCCGATGAAATTTGGAGTATATACAAAAGCTCACCTAAAAGTCCTCAGCCTACTGTGAGTCCCATCGATGAATATGGA
TCCCTTATATATGCTGGACGGTGGGGAGTCCATGGAGTTTCACTTCCAGGGAGGGTGACGTTTGCACCTGGAAATGTTGGATTTGCAACT
TTTGGTGCACCTCGACCTATGGAGACCCAGATAGTTAGTGATGAAACATGGAAGCTAATAGATGGCATATGGGATAAAAGGGTCGAGGAA
ATGAAAGCTGCTGTATCACTAGAAACTGAAGAAGACGAGGAGAAGCCAAAACTTCTGATGGCCAGTCATTTCCATAGATTCAACTTCCAA
GTATCCGATACAGGCAGGATGCTGCACTCTTCAATCATTGTTTGTTCTAGATACAAGGATCCAAACACACATTACTCGGACAAGCATTTT
GACATCAGTAGCATATTCCAGGTTTTTTTGAGATCAGAGCTAGACTCCCGCTATGCTAGAGGATTGGATGGTGATAAATTGTATGATGAT
GCTAGCCTTAAACATTACCCACTTATGACTGCTTTGGGAAATGCCGAGCTGAAAATTAACATCCCTAGTACCACAAGGAAAAGGTGCTCA
ACAGGGGCGAATAAXCCTATTCTAGATGATGGGTTACAACTTACAAGGTGCCCTTTTAGTCCXAATCAGCTCATCAACTTCCCCTGGGGT
CCCCAACAAGTTTTCGGAAGGTGCCCAATTACCGAAAATTTTGTAAATTATTCCCCTACACCAGCTCCAAACCCCCCCTTCCCCTATCCA
TTAAAGGCCCCCTCCCCAACTTTTGGAATAATCCTGGAGAACTCCACTTCCCTCTGTTTCAAAATACTGGTCTCAGGGGTTGTTATACTG
ACGACCCCTCTTGGCCCCAAATATATATTTTGGGGAACTTTAAAGCTTTTCCTCAAAAAAAAAAAAAAAAAAACCTCCGAGGGGGGCCCC
CGGCAACCAAATTTCCCCCTCATATGGACAGCCCATAATAAAACCGCCCCTCACCCTTCACCACTCCCCTACACTGCCCCAACTCCTCAC
TCAACCCCCTCCTCCATATCCCCTCCTCCCACTACACCACCX
Edits in Original Sequence 
(5')XXAATCCCGCGTGGCTCCGCTCACAATAGTGGATCCCCCGGGCTGCAGGAATTcGGCACGCCCTTCAATTACAGATGTGTTACTTG
AGAGAGGAGAGATCACAGCCGATGAAATTTGGAGTATATACAAAAGCTCACCTAAAAGTCCTCAGCCTACTGTGAGTCCCATCGATGAAT
ATGGATCCCTTATATATGCTGGACGGTGGGGAGTCCATGGAGTTTCACTTCCAGGGAGGGTGACGTTTGCACCTGGAAATGTTGGATTTG
CAACTTTTGGTGCACCTCGACCTATGGAGACCCAGATAGTTAGTGATGAAACATGGAAGCTAATAGATGGCATATGGGATAAAAGGGTCG
AGGAAATGAAAGCTGCTGTATCACTAGAAACTGAAGAAGACGAGGAGAAGCCAAAACTTCTGATGGCCAGTCATTTCCtATAGATTCAAC
TTCCAAGTATCCGATACAGGCAGGATGCTGCACTCTTCAATCATTGTTTGTTCTAGATACAAGGATCCAAACACACATTACTCGGACAAG
CATTTTGACATCAGTAGCATATTCCAGGTTTTTTTGAGATCAGAGCTAGACTCCCGCTATGCTAGAGGATTGGATGGTGATAAATTGTAT
cGATGATGCTAGCCTTAAACATTACCCACTTATGaACTGCTTTGGGAAATGCCGAGCTGAAAATTAACATCCCTAGTACCACAAGGAAAA
GGTGCTCAACAGGGGCGAATAAXCCTATTCTAGATGATGGGTTACAACTTACAAGGTGCCCTTTTAGTCCXAATCAGCTCATCAACTTCC
CCTGGGGTCCCCAACAAGTTTTCGGAAGGTGCCCAATTACCGAAAATTTTGTAAATTATTCCCCTACACCAGCTCCAAACCCCCCCTTCC
CCTATCCATTAAAGGCCCCCTCCCCAACTTTTGGAATAATCCTGGAGAACTCCACTTCCCTCTGTTTCAAAATACTGGTCTCAGGGGTTG
TTATACTGACGACCCCTCTTGGCCCCAAATATATATTTTGGGGAACTTTAAAGCTTTTCCTCAAAAAAAAAAAAAAAAAAACCTCCGAGG
GGGGCCCCCGGCAACCAAATTTCCCCCTCATATGGACAGCCCATAATAAAAcCCGCCCCTCACCCTTCACCACTCCCCTACACTGCCCCA
ACTCCTCACTCAACCCCCTCCTCCATATCCCCTCCTCCCACTACACCACCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan