ESTScan Details for Unigene SGN-U341761

Score 
426
Direction 
Forward
Predicted Peptide Sequence 
MAQAMQLHARLLKSGQEDPTHFQNLSKLFTFSALSPSGDLTYARHILTNLRTPNSYYYNTMIRAYSDSIDPTRSITLFLSMHCREEQPGV
VVPGPDKFTYPFVLKACSKLRNTQMGKQIHGLIFKSGLISDRYVNDAPIHMYAGWGDSGLALKVFDEMSERDVVSWTSMIDGFVDNNRPI
EAIKLSELMMESGRDPNDTTLVSVLRACADTGALSIGKKVITLXRKGSCMKANVVPTYCMSPNGGA
Predicted Coding Sequence 
ATGGCGCAAGCCATGCAGCTCCATGCCCGACTACTCAAATCGGGTCAAGAAGACCCAACCCATTTCCAAAATCTCAGCAAACTCTTCACT
TTCTCCGCTCTTTCGCCGTCCGGTGACCTCACCTACGCCCGCCATATCTTAACCAATCTCCGAACCCCAAATTCATACTACTACAACACC
ATGATTCGTGCATATTCGGATTCTATTGACCCGACCCGATCTATCACCCTCTTCCTCTCAATGCATTGCAGAGAAGAACAACCCGGGGTT
GTCGTACCCGGACCCGATAAGTTCACTTACCCGTTTGTACTTAAAGCTTGTTCGAAGTTACGGAATACCCAGATGGGGAAACAGATTCAT
GGGTTGATTTTCAAGTCGGGTTTGATATCGGACCGCTATGTGAACGATGCCCCTATCCATATGTATGCAGGTTGGGGTGATTCAGGTCTC
GCTTTGAAGGTGTTTGACGAAATGTCTGAAAGAGATGTTGTTTCTTGGACTTCAATGATTGATGGTTTTGTTGATAATAATAGACCTATA
GAAGCTATTAAGTTGTCTGAATTGATGATGGAGAGTGGCCGTGATCCGAACGACACTACTCTCGTTTCGGTTTTGAGAGCTTGTGCTGAT
ACTGGAGCTTTAAGCATTGGGAAGAAAGTCATAACTTTGTGAAGGAAAGGATCTTGCATGAAGGCTAATGTGGTACCGACTTATTGTATG
TCGCCAAATGGGGGTGCCTAA
Edits in Original Sequence 
GATCAACAATGGCGCAAGCCATGCAGCTCCATGCCCGACTACTCAAATCGGGTCAAGAAGACCC(5')ATGGCGCAAGCCATGCAGCTCC
ATGCCCGACTACTCAAATCGGGTCAAGAAGACCCAACCCATTTCCAAAATCTCAGCAAACTCTTCACTTTCTCCGCTCTTTCGCCGTCCG
GTGACCTCACCTACGCCCGCCATATCTTAACCAATCTCCGAACCCCAAATTCATACTACTACAACACCATGATTCGTGCATATTCGGATT
CTATTGACCCGACCCGATCTATCACCCTCTTCCTCTCAATGCATTGCAGAGAAGAACAACCCGGGGTTGTCGTACCCGGACCCGATAAGT
TCACTTACCCGTTTGTACTTAAAGCTTGTTCGAAGTTACGGAATACCCAGATGGGGAAACAGATTCATGGGTTGATTTTCAAGTCGGGTT
TGATATCGGACCGCTATGTGAACGATGCCCCTATCCATATGTATGCAGGTTGGGGTGATTCAGGTCTCGCTTTGAAGGTGTTTGACGAAA
TGTCTGAAAGAGATGTTGTTTCTTGGACTTCAATGATTGATGGTTTTGTTGATAATAATAGACCTATAGAAGCTATTAAGTTGTCTGAAT
TGATGATGGAGAGTGGCCGTGATCCGAACGACACTACTCTCGTTTCGGTTTTGAGAGCTTGTGCTGATACTGGAGCTTTAAGCATTGGGA
AGAAAGTCATAACTTTGTGAAGGAAAGGATCTTGCATGAAGGCTAATGTGGTACCGACTTATTGTATGTCGCCAAATGGGGGTGCCTAA
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan