ESTScan Details for Unigene SGN-U341826

Score 
601
Direction 
Forward
Predicted Peptide Sequence 
MEEASEHNTKDDCWVVIDGKVYDVSSYLDEHPGGDDVLLGVTGQDATDEFEDAGHSKSARELMEKFFIGELDTTSSSIPELEIVKKAGKD
IPQKLMEVTKQYWFVPVAAVGISVXAWLLVHTQEVKSVRYSVFNVSNIVQHRLKKLFVISLEVQEFGT
Predicted Coding Sequence 
ATGGAAGAAGCTTCTGAGCACAACACTAAGGATGATTGTTGGGTCGTCATTGACGGCAAGGTATATGATGTTTCATCTTATTTAGACGAA
CATCCAGGGGGAGATGATGTTCTACTTGGTGTTACAGGACAAGATGCCACTGATGAATTCGAAGATGCTGGACACAGCAAAAGCGCGAGA
GAACTTATGGAGAAATTCTTCATTGGGGAGCTTGATACAACATCCTCTTCCATCCCTGAACTTGAGATTGTCAAGAAGGCGGGCAAAGAT
ATTCCTCAGAAGTTAATGGAAGTTACTAAGCAATATTGGTTCGTTCCAGTAGCAGCCGTTGGCATCTCTGTTGXTGCTTGGCTTCTTGTT
CACACGCAAGAAGTAAAATCAGTTCGATATTCCGTCTTTAATGTTAGTAATATTGTGCAACATAGACTGAAAAAATTATTCGTCATATCT
TTGGAGGTCCAGGAATTTGGGACATGA
Edits in Original Sequence 
GGCCAACTTTAACGAAGTTATTCACAATGGAAGAAGCTTCTGAGCACAACACTAAGGATGATTGTTGGGTCGTCATTGACGGCAAGGTAT
ATG
(5')ATGGAAGAAGCTTCTGAGCACAACACTAAGGATGATTGTTGGGTCGTCATTGACGGCAAGGTATATGATGTTTCATCTTATTT
AGACGAACATCCAGGGGGAGATGATGTTCTACTTGGTGTTACAGGACAAGATGCCACTGATGAATTCGAAGATGCTGGACACAGCAAAAG
CGCGAGAGAACTTATGGAGAAATTCTTCATTGGGGAGCTTGATACAACATCCTCTTCCATCCCTGAACTTGAGATTGTCAAGAAGGCGGG
CAAAGATATTCCTCAGAAGTTAATGGAAGTTACTAAGCAATATTGGTTCGTTCCAGTAGCAGCCGTTGGCATCTCTGTTGXTGCTTGGCT
TCTTGTTCACACGCAAGAAGTAAAATCAGTTCGATATTCCGTCTTTAATGTTAGTAATATTGTGCAACATAGACTGAAAAAATTATTCGT
CATATCTTTGGAGGTCCAGGAATTTGGGACATGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan