ESTScan Details for Unigene SGN-U341831

Score 
346
Direction 
Forward
Predicted Peptide Sequence 
IVVGEKMLLRGPRLNCDCTPNEIRSAFRKLALQRHPDKLVRSGVPEFEATAIFQELVNAYDVLSDAQERASYDSQRSAYQILFSNSDPKN
SSNYSGSVPDLSSFFSNSVYSGYSDERKGFYKVYGDLFEKIYHRELNLARKLGTNLPEEAPIMGNMQSPYAQVTAFYNYWLGFATVNDFC
QSDVYKSTLASDRNSRRMMEDINKKLRKKAKRDYNVTXRGLXEFCKXRDRRMNGMPMKRIGNLRKKMKKDPRRMGEFGKRRRLKEQENTF
RPNWAETPGISRLGASKKEGSGEGAKKEGFVLVGVWEKIHRGKTLGKFPPVPEPLGKGKNGPFSMTX
Predicted Coding Sequence 
ATTGTCGTCGGAGAAAAGATGCTTTTACGAGGTCCTCGGCTGAACTGCGACTGCACCCCGAACGAGATCAGGTCGGCTTTCAGGAAGCTC
GCACTGCAACGCCATCCTGACAAGCTCGTCCGATCCGGCGTGCCGGAATTTGAAGCAACCGCTATATTTCAGGAGCTTGTGAACGCTTAC
GACGTTCTCTCAGACGCGCAGGAGCGTGCTTCGTACGATTCCCAGCGCTCTGCCTATCAGATACTCTTCTCCAATTCCGATCCAAAGAAT
TCGTCTAATTACTCCGGTTCCGTTCCCGATCTGTCCTCCTTCTTTTCAAATTCAGTGTATTCTGGATATTCCGATGAGAGGAAAGGATTC
TACAAGGTGTACGGTGATCTCTTCGAGAAAATCTACCACCGTGAGTTGAATTTGGCTAGGAAGTTAGGTACAAATTTGCCAGAAGAAGCT
CCTATTATGGGAAATATGCAGAGTCCTTATGCTCAGGTTACGGCATTCTATAACTATTGGTTAGGATTCGCTACTGTGAATGATTTTTGT
CAGTCAGATGTGTACAAATCGACTTTGGCATCGGACAGAAATTCCAGACGGATGATGGAAGATATTAACAAGAAGCTGAGGAAAAAGGCG
AAAAGGGATTACAATGTGACTGNTAGAGGATTAANCGAATTTTGTAAANGGAGAGATAGGAGAATGAATGGAATGCCNATGAAGAGGATT
GGGAACCTTAGAAAAAAAATGAAGAAAGACCCCAGGAGAATGGGAGAATTTGGAAAGAGAAGAAGGCTGAAAGAACAAGAAAATACCTTT
AGGCCTAATTGGGCCGAGACCCCAGGAATTTCCAGATTGGGGGCTTCTAAAAAGGAGGGTTCGGGGGAGGGGGCCAAAAAGGAGGGATTT
GTCCTTGTGGGGGTTTGGGAAAAAATTCACAGAGGGAAAACATTGGGAAAATTCCCGCCGGTCCCCGAACCTTTGGGGAAAGGGAAAAAT
GGGCCCTTTTCCATGACCAAX
Edits in Original Sequence 
GCGGCATTGTCGTCGGAGAAAAGATGCTTTTACGAGGTCCTCGGCGTGAACTGCGACTGCACCCCGAACGAGATCAGGTCGGCTTTCAGG
AAGCTCGCACTGCAA
(5')ATTGTCGTCGGAGAAAAGATGCTTTTACGAGGTCCTCGGCgTGAACTGCGACTGCACCCCGAACGAGATCA
GGTCGGCTTTCAGGAAGCTCGCACTGCAACGCCATCCTGACAAGCTCGTCCGATCCGGCGTGCCGGAATTTGAAGCAACCGCTATATTTC
AGGAGCTTGTGAACGCTTACGACGTTCTCTCAGACGCGCAGGAGCGTGCTTCGTACGATTCCCAGCGCTCTGCCTATCAGATACTCTTCT
CCAATTCCGATCCAAAGAATTCGTCTAATTACTCCGGTTCCGTTCCCGATCTGTCCTCCTTCTTTTCAAATTCAGTGTATTCTGGATATT
CCGATGAGAGGAAAGGATTCTACAAGGTGTACGGTGATCTCTTCGAGAAAATCTACCACCGTGAGTTGAATTTGGCTAGGAAGTTAGGTA
CAAATTTGCCAGAAGAAGCTCCTATTATGGGAAATATGCAGAGTCCTTATGCTCAGGTTACGGCATTCTATAACTATTGGTTAGGATTCG
CTACTGTGAATGATTTTTGTCAGTCAGATGTGTACAAATCGACTTTGGCATCGGACAGAAATTCCAGACGGATGATGGAAGATATTAACA
AGAAGCTGAGGAAAAAGGCGAAAAGGGATTACAATGTGACTGNTAGAGGATTAANCGAATTTTGTAAANGGAGAGATAGGAGAATGAATG
GAATGCCNATGAAGAgGGATTGGGAACCTTAGAAAAAAAATGAAGAAAGACCCCAGGAGAATGGGAGAATTTGGAAAGAGAAGAAGGCTG
AAAGAACAAGAAAATACCTTTAGGCCTAATTGGGCCGAGACCCCAGGAATTTCCAGATTGGGGGCTTCTAAAAAGGAGGGTTCGGGGGAG
GGGGCCAAAAAGGAGGGATTTGTCCTTGTGGGGGTTTGGGAAAAAATTCACAGAGGGAAAACATTGGGAAAATTCCCGCCGGTCCCCGAA
CCTTTGGGGAAAGGGAAAAATGGGCCCTTTTCCATGACCAAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan