ESTScan Details for Unigene SGN-U341841

Score 
479
Direction 
Forward
Predicted Peptide Sequence 
FKAGSSTAVGGRSRTSGSPGLQEFGXEEQATITLPTLRIHNLARFRIPIFQSQPYHSHHRFHRHNSKSSAETQKPHNTTRNLLRKPIPLL
ADLKQIQDPDEAISLFHYYQQMGFKHDYPTYSCLVYKLAKSQNFEVVETLLGYLQTHHIRCKETLFIGLIQHYGRAQLVDKAVELFHKIG
SFNCSPSVQSFNAILNVLVDSGRSEAANEMLRSCSKMGIWLNSVSVYIIIKMWLKKGDWEMARQLFDEMLERGVEPTVVLTIVNWVFVKK
GDVEDAKSLFQDMFRKGKKANACP
Predicted Coding Sequence 
XXTTTTAAAGCTGGGAGCTCCACCGCGGTGGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCXACGAGGAACAA
GCTACCATAACTCTTCCAACACTCAGAATTCACAATCTTGCACGATTCAGAATCCCAATTTTCCAGTCCCAACCATACCACAGTCATCAT
CGTTTTCACAGACACAATTCAAAATCTTCAGCTGAAACTCAAAAGCCTCATAACACCACAAGAAACCTTCTTCGCAAACCAATACCACTC
CTTGCAGACCTCAAACAAATCCAAGATCCTGATGAAGCTATTTCACTCTTCCATTATTATCAACAAATGGGGTTCAAACATGACTACCCA
ACTTATTCTTGTCTTGTTTATAAGCTCGCAAAGTCTCAAAATTTTGAAGTTGTTGAAACCCTTCTTGGATATCTCCAAACTCATCATATT
CGATGTAAAGAAACACTTTTTATTGGGTTAATTCAACACTATGGGAGAGCCCAGTTAGTTGATAAAGCTGTTGAGCTTTTTCACAAAATT
GGGTCGTTTAATTGTTCGCCTAGTGTGCAGTCTTTTAATGCAATTCTGAATGTGCTTGTTGATAGTGGACGTTCTGAAGCTGCTAATGAG
ATGTTAAGGAGTTGTTCGAAAATGGGTATCTGGTTAAATTCTGTTTCXGTTTACATTATTATCAAGATGTGGCTGAAGAAGGGTGATTGG
GAAATGGCTCGCCAACTGTTTGATGAAATGCTTGAAAGAGGGGTTGAGCCAACAGTGGTTCTTACAATTGTCAATTGGGTTTTTGTGAAG
AAGGGGGATGTTGAAGATGCTAAAAGTCTGTTTCAGGATATGTTTAGAAAGGGAAAGAAGGCAAATGCATGTCCT
Edits in Original Sequence 
(5')XXTTTTAAAGCTGGGAGCTCCACCGCGGTGGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCXACGAGGA
ACAAGCTACCATAACTCTTCCAACACTCAGAATTCACAATCTTGCACGATTCAGAATCCCAATTTTCCAGTCCCAACCATACCACAGTCA
TCATCGTTTTCACAGACACAATTCAAAATCTTCAGCTGAAACTCAAAAGCCTCATAACACCACAAGAAACCTTCTTCGCAAACCAATACC
ACTCCTTGCAGACCTCAAACAAATCCAAGATCCTGATGAAGCTATTTCACTCTTCCATTATTATCAACAAATGGGGTTCAAACATGACTA
CCCAACTTATTCTTGTCTTGTTTATAAGCTCGCAAAGTCTCAAAATTTTGAAGTTGTTGAAACCCTTCTTGGATATCTCCAAACTCATCA
TATTCGATGTAAAGAAACACTTTTTATTGGGTTAATTCAACACTATGGGAGAGCCCAGTTAGTTGATAAAGCTGTTGAGCTTTTTCACAA
AATTGGGTCGTTTAATTGTTCGCCTAGTGTGCAGTCTTTTAATGCAATTCTGAATGTGCTTGTTGATAGTGGACGTTCTGAAGCTGCTAA
TGAGATGTTAAGGAGTTGTTCGAAAATGGGTATCTGGTTAAATTCTGTTTCXGTTTACATTATTATCAAGATGTGGCTGAAGAAGGGTGA
TTGGGAAATGGCTCGCCAACTGTTTGATGAAATGCTTGAAAGAGGGGTTGAGCCAACAGTGGTTaCTTACAATTGTCAATTGGGTTTTTG
TGtAAGAAGGGGGATGTTGAAGATGCTAAAAGTCTGTTTCAGGATATGTTTAGAAAGGGAAAGAAGGCAAATGCATGTCCT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan