ESTScan Details for Unigene SGN-U342061

Score 
-324
Direction 
Reverse
Predicted Peptide Sequence 
GAPRAAQGGPIAGANFNLPKKGDKAMFFYTRQVIGAPFPVGELLRDSSAIKKGRGLTRGSQGPPRLLNRPLNTGVQHWTGQVNKEFLHKX
NARRKGFPTAPYWLSGKXTTPKSSRWVIGNKKPSPSEPTKPIASKGPNLIALLFFPIVIYSNHPKQFMIVTALDAIRSPNAIQIAMIKAV
IVRNLAHHGTDFGVDLISQMDPDPRNPKDTVFIRVIHNTDQGFSRDGKXEIEKSCFLRINDETSEPGLVRYGKKEGRRIQLQQASGXALR
EALQDGVDEKNTNKPRAEFLQPGGSTSSRAAATAVG
Predicted Coding Sequence 
GGGGCCCCCCGGGCGGCCCAGGGGGGTCCCATAGCCGGGGCCAATTTTAATTTGCCAAAAAAGGGGGATAAAGCAATGTTTTTTTACACT
CGCCAGGTTATAGGGGCACCTTTTCCGGTGGGAGAACTTTTGAGAGATTCTTCCGCCATAAAGAAGGGCCGCGGCCTTACCCGGGGTTCC
CAAGGGCCXCCCCGCCTTTTGAATAGGCCCCTAAACACGGGTGTCCAACATTGGACCGGGCAAGTGAACAAAGAATTCCTTCATAAAXCC
AATGCACGCCGTAAGGGCTTCCCAACTGCTCCGTATTGGCTCTCCGGGAAAATXACAACCCCAAAAAGTAGTCGGTGGGTAATCGGCAAT
AAAAAACCAAGCCCGTCCGAACCAACAAAGCCAATTGCTAGCAAGGGTCCAAATCTCATAGCATTACTCTTTTTCCCAATCGTCATTTAC
AGTAATCATCCAAAGCAGTTTATGATTGTGACXGCCCTTGACGCCATCAGATCCCCGAATGCCATCCAAATCGCTATGATTAAAGCTGTA
ATTGTTCGCAACCTTGCXCATCATGGAACAGATTTTGGAGTGGACCTCATAAGCCAGATGGACCCAGATCCCAGGAACCCTAAAGATACG
GTTTTTATCCGXGTAATTCACAATACAGATCAGGGTTTCAGTAGAGACGGTAAAGXGGAGATTGAAAAAAGTTGTTTCTTAAGGATTAAT
GATGAAACCAGTGAACCAGGGTTGGTGAGATACGGGAAGAAAGAAGGAAGGAGAATCCAGCTTCAACAAGCTTCTGGTXATGCCCTAAGA
GAAGCCCTACAAGATGGTGTTGATGAGAAGAACACCAACAAGCCTCGTGCCGAATTCCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCG
GCCGCCACCGCGGTGGGA
Edits in Original Sequence 
CATAAGCCAGATGGACCCAGATCCCAGGAACCCTAAAGATACGGTTTTTATCCGGTAATTCACAATACAGATCAGGGTTTCAGTAGAGAC
GGTAAAGGGAGATTGAAAAAAGTTGTTTCTTAAGGAT
(5')GGGGCCCCCCGGGCGGCCCAGGGGGGTCCCATAGCCGGGGcCCAATTTT
AATTTGCCAAAAAAGGGGGATAAAGCAATGTTTTTTTACACTCGcCCAGGTTATAGGGGCACCTTTTCCGGTGGGAGAACTTTTGAGAGA
TTCTTCCGCCATAAAGAAGGGCCGCGGCCTTACCCGGGGTTCCCAAGGGCCXCCCCGCCTTTTGAATAGGCCCCTAAACACGGGTGTCCA
ACATTGGACCGGGCAAGTGAACAAAGAATTCCTTCATAAAXCCAATGCACGCCGTAAGGGCTTCCCAACTGCTCCGTATTGGCTCTCCGG
GAAAATXACAACCCCAAAAAGTAGTCGGTGGGTAATCGGCAATAAAAAACCAAGCCCGTCCGAACCAACAAtAGCCAATTGCTAGCAAGG
GTCCAAATCTCATAGCATTACTCTTTTTCCCAATCGTCATTTACAGTAATCATCCAAAGCAGTTTATGATTGTGACXGCCCTTGACGCCA
TCAGATCCCCGAATGCCATCCAAATCGCTATGATTAAAGCTGTAATTGTTCGCAACCTTGCXCATCATGGAACAGATTTTGGAGTGGACC
TCATAAGCCAGATGGACCCAGATCCCAGGAACCCTAAAGATACGGTTTTTATCCGXGTAATTCACAATACAGATCAGGGTTTCAGTAGAG
ACGGTAAAGXGGAGATTGAAAAAAGTTGTTTCTTAAGGATTAATcGATGAAACCAGTGAACCAGGGTTGGTGAGATACGGGAAGAAAGAA
GGAAGGAGAATCCAGCTTCAACAAGCTTCTGGTXATGCCCTAAGAGAAGCCCTACAAGATGGTGTTGATGtAGAAGAACACCAACAAGCC
TCGTGCCGAATTCCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCGCCACCGCGGTGGGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan