ESTScan Details for Unigene SGN-U342068

Score 
47
Direction 
Forward
Predicted Peptide Sequence 
GNARXRXYDTTAHRRGRGRSRTSGSPGLQEFGTRINSAMQNFGSRLIDXIYQPPAAGGGNCDDENYKSLCSICLSEYVKDNTIGTLGCGH
EYXRNLHTTMAAEGQEELSNL
Predicted Coding Sequence 
XGGGGNAACGCGCGGGNCCGTNNNTATGATACTACTGCTCATCGCCGCGGTCGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAG
GAATTCGGCACGAGGATTAATAGTGCAATGCAAAACTTTGGTAGTCGTCTCATTGATXTGATCTACCAGCCCCCAGCAGCAGGAGGAGGA
AATTGTGATGATGAAAACTACAAGTCATTGTGTTCCATATGTCTATCTGAATATGTAAAGGACAACACAATTGGTACACTCGGTTGTGGA
CATGAATATCXACGCAACTTGCATACAACAATGGCTGCTGAGGGGCAAGAAGAATTGTCCAATCTGTAG
Edits in Original Sequence 
(5')XGGGGNAACGCGCGGGNCCGTNNNTATGATACTACTGCTCATCGCCGCGGTCGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCT
GCAGGAATTCGGCACGAGGATTAATAGTcGCAATGCAAAACTTTGGTAGTCGTCTCATTGATXTGATCTACCAGCCCCCAGCAGCAGGAG
GAGGAAATTGTGATGATGAAAACTACAAGTCATTGTGTTCCATATGTCTATCTGAATATGTAAAGGACAACACAATTGGTACACTCGGTT
GTGGACATGAATATCXACGCAACTTGCATACAACAATGGCTGCTGAGGGGCAAGAAGAATTGTCCAATCTGTAG(3')TTGTTGGTGATT
GAATTCACCTTCTAGAACAATTCTGCAACTCAATTTATGGAATTATTCTTTACAAAAAAAAAAAAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan