Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U342096

Score 
374
Direction 
Forward
Predicted Peptide Sequence 
IAGAHRGGGRSRTSGSPGLQEFGXEGYPNQSGKKKDGATAYDTFQLLNNSPSKIDAIESYRSNLLIACSDGSLRVYVPESSVSDQSDFHS
ETLGLHQGPYVLXKNSEWILQKTNAGHGSPRLRELLLSLSESIALHRLPDLETLSVITKAKGANDIRGMINEGYFASAGKKESXIYKHDG
GSGFVEVKEFGVPDTVKSMSWCGENICLGIRREYKILNTTNGVLSEVFSSGRIAAPLVVALPPGELLLGKDNIGILVNKKGSDPRKEDLL
AEAPAAVX
Predicted Coding Sequence 
XXAATAGCTGGAGCTCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCXACGAGGGCTACCCAAAT
CAATCAGGGAAGAAGAAAGATGGTGCCACTGCCTACGATACCTTCCAACTCCTCAATAATTCTCCCTCCAAAATCGATGCCATTGAATCA
TACCGCTCAAATTTGCTCATCGCATGTTCCGATGGATCGCTCCGTGTTTACGTTCCAGAATCCTCAGTTTCCGATCAATCTGATTTCCAT
TCCGAAACCTTAGGGCTTCATCAAGGACCATATGTGCTTGAXAAGAACTCTGAATGGATTCTCCAGAAGACAAATGCTGGCCATGGAAGT
CCTCGTCTCAGAGAACTTCTGCTTTCCCTCTCCGAGTCAATTGCGTTACATCGATTGCCTGATTTGGAGACTTTATCAGTGATTACTAAG
GCTAAAGGTGCAAATGATATTCGTGGGATGATAAACGAGGGTTACTTTGCTTCGGCAGGCAAAAAAGAGTCTGXTATTTACAAACACGAC
GGGGGGAGTGGATTTGTGGAGGTGAAAGAATTTGGAGTACCTGACACAGTTAAGTCGATGTCATGGTGTGGTGAGAATATTTGCTTGGGG
ATTAGAAGAGAGTACAAGATATTGAATACCACTAATGGTGTATTGTCTGAGGTGTTCTCTTCAGGNAGGATCGCCGCACCTCTTGTGGTG
GCTCTTCCACCCGGAGAACTACTTTTGGGCAAGGATAATATTGGTATCTTAGTTAACAAAAAGGGAAGTGATCCAAGAAAGGAGGATTTG
TTGGCTGAAGCTCCTGCAGCTGTTAXX
Edits in Original Sequence 
(5')XXAATAGCTGGAGCTCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCXACGAGGGCTACCC
AAATCAATCAGGGAAGAAGAAAGATGGTGCaCACTGCCTACGATACCTTCCAACTCCTCAATAATTCTCCCTCCAAAATCGATGCCATTG
AATCATACCGCTCAAATTTGCTCATCGCATGTTCCGATGGATCGCTCCGTGTTTACGTTCCAGAATCCTCAGTTTCCGATCAATCTGATT
TCCATTCCGAAACCTTAGGGCTTCATCAAGGACCATATGTGCTTGAXAAGAACTCTGAATGGATTCTCCAGAAGACAAATGCTGGCCATG
GAAGTCCTCGTCTCAcGAGAACTTCTGCTTTCCCTCTCCGAGTCAATTGCGTTACATCGATTGCCTGATTTGGAGACTTTATCAGTGATT
ACTAAGGCTAAAGGTGCAAATGtATATTCGTGGGATGATAAACGAGGGTTACTTTGCTTCGGCAGGCAAAAAAGAGTCTGXTATTTACAA
ACACGACGGGGGGAGTGGATTTGTGGAGGTGAAAGAATTTGGAGTACCTGACACAGTTAAGTCGATGTCATGGTGTGGTGAGAATATTTG
CTTGGGGATTAGAAGAGAGTACAAGATATTGAATACCACTAATGGTGTATTGTCTGAGGTGTTCTCTTCAGGNAGGATCGCCGCACCTCT
TGTGGTGGCTCTTCCACCCGGAGAACTACTTTTGGGCAAGGATAATATTGGTATCTTAGTTAACAAAAAcGGGAAGTGATCCAAGAAAGG
AGGATTTGTTGGtCTGAAGCTCCTGCAGCTGTTAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan