ESTScan Details for Unigene SGN-U342110

Score 
667
Direction 
Forward
Predicted Peptide Sequence 
MKESAPYLNTVCIYGGVSYATQQNALSRGVDVVVGTPGRLIDLINNNTLKLGEVEYLVLDEADQMLAVGFEEDVEVILEKLPPQRQSMLF
SATMPGWVKKLSRKYLNNPLTIDLVGDQDEKLAEGIKLYALSATSTSKRSILGDLCTVYAKGGKTIVFTQTKRDADEVSLALSNSISSEA
LHGDISQHQRGKTLNGIRQGKFTVLVATXRXIPGPGIPNVDYDPFDYXNIQNFVHSSGQXGRSKKEMLFLFPVVKGTANFNGVGAGXKFI
SPSKI
Predicted Coding Sequence 
ATGAAAGAGTCGGCACCGTACTTGAACACAGTCTGCATATACGGAGGCGTTTCTTATGCTACACAGCAAAATGCACTTTCCCGTGGGGTT
GATGTTGTTGTTGGAACTCCAGGTAGACTTATTGACCTGATAAACAATAACACCTTGAAACTTGGGGAGGTGGAATATTTGGTCCTCGAC
GAGGCTGATCAAATGCTCGCAGTTGGATTTGAGGAAGATGTGGAAGTTATTTTGGAAAAACTTCCACCACAGAGGCAAAGCATGCTTTTC
TCAGCCACCATGCCTGGCTGGGTAAAGAAACTGTCTAGGAAGTACTTGAACAATCCTTTGACAATTGACTTGGTTGGAGATCAAGATGAA
AAGCTGGCAGAGGGGATCAAGCTTTATGCTCTATCAGCAACATCAACATCAAAACGATCTATACTTGGTGATCTTTGTACAGTTTATGCA
AAGGGTGGAAAGACAATTGTTTTTACACAGACAAAACGAGATGCTGATGAGGTTTCACTGGCCTTATCAAATAGCATTTCTTCTGAAGCA
TTGCATGGTGACATTTCTCAACATCAGAGGGGAAAGACACTAAATGGGATTAGGCAAGGGAAATTCACTGTGCTTGTTGCGACTGAXCGT
NGCATCCCGGGGCCTGGTATACCTAATGTNGACTATGATCCATTTGATTACCXCAACATCCAGAACTTTGTTCATTCTTCTGGTCAACXG
GGCCGCTCGAAAAAAGAAATGCTTTTTCTTTTCCCGGTGGTCAAGGGAACTGCGAACTTTAACGGAGTTGGGGCAGGTXATAAATTTATC
TCCCCTTCAAAGATTTAA
Edits in Original Sequence 
AAAGTTTTGGTACTTGCACCTACTCGAGAGTTAGCCAATCAAGTTGAGAAGGAAATGAAAGAGTCGGCACCGTACTTGAACACAGTCTGC
ATATACGGAGGCGTTTCTTATGCTACACAGCAAAATGCACTTTCCCGTGGGGTTGATGTTGTTGTTGGAACTCCAGGTAGACTTA
(5')A
TGAAAGAGTCGGCACCGTACTTGAACACAGTCTGCATATACGGAGGCGTTTCTTATGCTACACAGCAAAATGCACTTTCCCGTGGGGTTG
ATGTTGTTGTTGGAACTCCAGGTAGACTTATTGACCTGATAAACAATAACACCTTGAAACTTGGGGAGGTGGAATATTTGGTCCTCGACG
AGGCTGATCAAATGCTCGCAGTTGGATTTGAGGAAGATGTGGAAGTTATTTTGGAAAAACTTCCACCACAGAGGCAAAGCATGCTTTTCT
CAGCCACCATGCCTGGCTGGGTAAAGAAACTGTCTAGGAAGTACTTGAACAATCCTTTGACAATTGACTTGGTTGGAGATCAAGATGAAA
AGCTGGCAGAGGGGATCAAGCTTTATGCTCTATCAGCAACATCAACATCAAAACGATCTATACTTGGTGATCTTTGTACAGTTTATGCAA
AGGGTGGAAAGACAATTGTTTTTACACAGACAAAACGAGATGCTGATGAGGTTTCACTGGCCTTATCAAATAGCATTTCTTCTGAAGCAT
TGCATGGTGACATTTCTCAACATCAGAGGGGAAAGACACTAAATGGGATTAGGCAAGGGAAATTCACTGTGCTTGTTGCGACTGAXCGTN
GCATCCCGGGGCCTGGTATACCTAATGTNGACTAgTGATCCATTTGATTACCXCAACATCCAGAACTTTGTTCATTCTTCTGGTCAACXG
GGCCGCTCGAAAAAAGAAATGCTTTTTCTTTTCCCGGTGGTCAAGGGAACTGCGAACTTTAACGGAGTTGGGGCAGGTXATAAATTTATC
TCCCCTTCAAAGATTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan