ESTScan Details for Unigene SGN-U342141

Score 
471
Direction 
Forward
Predicted Peptide Sequence 
MXWKPSKSWWKKGAVPNIITYNILIESLCKSRKLMKALELLEDIQNRGLIPDTVSCGTLINGFCENEDLDGAYELFRRMRRQYKYFHTTA
TYNIMISAFSKKLKMDMADKLFLEMNECGCPPDSYTYRCMIDGFCKVDNTEFGYKFLLENFSKELLPSKETAGQVINCLCVKNRLLDAIG
IIHLMVQKSVVPHVVHTIFEVNKKEVAAPXNVVEDC
Predicted Coding Sequence 
ATGTGATGGAAACCTTCAAAGTCATGGTGGAAAAAGGGTGCXGTCCCAAATATAATCACATATAATATACTCATTGAAAGCCTCTGTAAA
TCTAGAAAGCTTATGAAAGCTTTAGAATTACTTGAGGATATTCAAAACAGGGGTCTTATTCCTGATACAGTGAGTTGTGGCACTCTGATA
AATGGGTTTTGTGAGAATGAGGATTTGGATGGAGCTTATGAGCTATTCAGAAGAATGAGAAGGCAATATAAGTATTTTCATACTACTGCA
ACATACAATATAATGATCAGTGCATTTTCTAAAAAGCTGAAAATGGACATGGCAGATAAGCTTTTTCTTGAGATGAATGAATGTGGCTGT
CCTCCTGACAGCTACACATACCGTTGTATGATAGATGGTTTCTGCAAGGTCGACAATACTGAATTTGGATACAAGTTTTTGCTTGAAAAC
TTTTCGAAAGAACTTCTTCCATCAAAAGAAACAGCGGGACAAGTGATCAATTGCCTATGTGTGAAGAACAGGTTACTCGATGCAATTGGT
ATCATTCATCTCATGGTGCAAAAAAGTGTTGTCCCTCATGTGGTTCACACAATTTTTGAAGTAAATAAAAAAGAAGTGGCGGCTCCTAAN
AATGTTGTGGAAGACTGCTGA
Edits in Original Sequence 
GTGAATGGACTTTGCAAGCTTAAAACTTCTGATGATGTGATGGAAACCTTCAAAGTCATGGTGGAAAAAGGGTGCGTCCCAAATATAATC
ACATATAATATACTCATTGAAAGCCTCTGTAAATCTAGAAAGCTTATGAAAGCTTTAGAATTACTTGA
(5')ATGTGATGGAAACCTTCA
AAGTCATGGTGGAAAAAGGGTGCXGTCCCAAATATAATCACATATAATATACTCATTGAAAGCCTCTGTAAATCTAGAAAGCTTATGAAA
GCTTTAGAATTACTTGAGGATATTCAAAACAGGGGTCTTATTCCTGATACAGTGAGTTGTGGCACTCTGATAAATGGGTTTTGTGAGAAT
GAGGATTTGGATGGAGCTTATGAGCTATTCAGAAGAATGAGAAGGCAATATAAGTATTTTCATACTACTGCAACATACAATATAATGATC
AGTGCATTTTCTAAAAAGCTGAAAATGGACATGGCAGATAAGCTTTTTCTTGAGATGAATGAATGTGGCTGTCCTCCTGACAGCTACACA
TACCGTTGTATGATAGATGGTTTCTGCAAGGTCGACAATACTGAATTTGGATACAAGTTTTTGCTTGAAAACTTTTCGAAAGAACTTCTT
CCATCAAAAGAAACAGCGGGACAAGTGATCAATTGCCTATGTGTGAAGAACAGGTTACTCGATGCAATTGGTATCATTCATCTCATGGTG
CAAAAAAGTGTTGTCCCTCATGTGGTTCACACAATTTTTGAAGTAAATAAAAAAGAAGTGGCGGCTCCTAANAATGTTGTGGAAGACTGC
TGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan