ESTScan Details for Unigene SGN-U342158

Score 
-105
Direction 
Forward
Predicted Peptide Sequence 
TIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPSPFPTVAQPEWRMANCKR
Predicted Coding Sequence 
ACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGCCTTGCAGCACATCCCCCTTTCG
CCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGTCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCAAATTGTAAGCGTTAA
Edits in Original Sequence 
GAGAATCCTTAGCAAAGAAAGAGAAACAGTAATTTACTTTTACCGGTAACTTACAGTGTGATCAACGCGACACTGATCTCCATACGACTT
TTGTTGCTTTGGCCTGCCAATGATATGCCGGTCCAACGTACTCCATGGCAACAAAACAGAGCTAAGTCAATTTTGTTTGGCATTCTTGTT
TTGGTTTAAAGTTTTTCTTTACGTTTTTGAGTTTTTGTTGTTAGGATGAATTTGTTGTAGAATTTGCATAGTATTTGATAATCAAAACTC
GACTTACTCCATTTGGTATGAAAAAGTGACTACTGTTTATTTCTTTTAGAGGCTTCAATGATTATATCAAAATCTTGCTTTGTC
(5')AC
AATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGCCTTGCAGCACATCCCCCTTTCGCC
AGCTGGCGTAATAGCGAAGAGGCCCGCACCGaTCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCAAATTGTAAGCGTTAA
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan