ESTScan Details for Unigene SGN-U342166

Score 
-298
Direction 
Reverse
Predicted Peptide Sequence 
MXRFTKINAILQYISXQLPSPFRLRTCWKGDPGGLFAITPAGKGGWCKAIKLGYARVFPVTTLXNDXPVNCNTTHYRANWVRGPPSSFFF
FFLREREKKSINIIITNPYEHLNKVYYHFAHYDYQTAKHEFSISDGKCFLIDKLIYSNSKRVSIASPADYXDEGYFKDTQAWQYKTIPYA
RNSNXTNYMYNQYYIMIKSLKGMHHFLSDPPRPHTKFAVESDNFVAEQALPSAEELDRXPTWRDEQQKIFTPRECNYEKKHKSQTKAKPG
LVPEFLQPGGSTSSRAAXHSGGAXSQEV
Predicted Coding Sequence 
ATGTAGCGATTTACGAAAATTAACGCGATTTTACAATATATTAGCTTNCAATTGCCATCGCCATTCAGGCTGCGCACTTGTTGGAAGGGC
GATCCGGGCGGGCTTTTCGCTATTACGCCAGCTGGGAAGGGGGGATGGTGCAAGGCGATTAAGTTGGGTTACGCCAGGGTTTTCCCAGTC
ACGACGTTGTANAACGACGXGCCAGTGAATTGTAATACGACTCACTATAGGGCGAATTGGGTACGGGGCCCCCCCTCGAGTTTTTTTTTT
TTTTTTTTAAGAGAAAGAGAAAAGAAATCTATAAATATAATCATCACCAATCCATATGAACATTTAAACAAAGTATATTATCACTTTGCA
CATTATGACTACCAAACTGCAAAGCATGAATTCAGTATTTCAGACGGGAAATGTTTTCTCATTGACAAGCTGATTTACTCGAACAGCAAG
AGAGTTTCGATTGCATCTCCTGCAGATTACXATGACGAAGGCTACTTCAAAGATACACAAGCTTGGCAGTACAAGACAATACCATATGCA
AGAAATTCTAATGXAACGAATTACATGTATAATCAATACTACATCATGATAAAAAGTCTGAAGGGTATGCATCATTTTTTGTCAGATCCT
CCAAGACCACATACAAAATTTGCXGTAGAAAGTGATAACTTTGTGGCTGAACAAGCATTACCTTCAGCAGAAGAACTCGATAGAXTTCCC
ACGTGGAGGGATGAACAACAGAAAATTTTCACGCCCAGAGAATGTAACTATGAGAAAAAGCATAAAAGCCAAACTAAAGCAAAACCCGGC
CTCGTGCCXGAATTCCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCNGCCACAGCGGTGGAGCTNCCAGCCAAGAAGTX
Edits in Original Sequence 
ATAATCATCACCAATCCATATGAACATTTAAACATAAGTATATTATCACTTTGCACATTATGACTACCAAACTGCAAAGCATGAA(5')A
TGTAGCGATTTACGAAAATTAACGCGATTTTACAATATATTAGCTTNCAATTGCCATCGCCATTCAGGCTGCGCACTTGTTGGAAGGGCG
ATCCGGGCGGGCTTTTCGCTATTACGCCAGCTGGGAAGGGGGGATGtGTGCAAGGCGATTAAGTTGGGTTACGCCAGGGTTTTCCCAGTC
ACGACGTTGTANAACGACGXGCCAGTGAATTGTAATACGACTCACTATAGGGCGAATTGGGTACGGGGCCCCCCCTCGAGTTTTTTTTTT
TTTTTTTTAAGAGAAAGAGAAAAGAtAATCTATAAATATAATCATCACCAATCCATATGAACATTTAAACAtAAGTATATTATCACTTTG
CACATTATGACTACCAAACTGCAAAGCATGAATTCAGTATTTCAGACGGGAAATGTTTTCTCATTGACAAGCTGATTTACTCGAACAGCA
AGAGAGTTTCGATTGCATCTCCTGCAGATTACXATGACGAAGGCTACTTCAAAGATACACAAGCTTGGCAGTACAAGACAATACCATATG
CAAGAAATTCTAATGXAACGAATTACATGTATAATCAATACTACATCATGATAAAAAGTCTGAAGGGTATGCATCATTTTTTGTCAGATC
CTCCAAGACCACATACAAAATTTGCXGTAGAAAGTGATAACTTTGTGGCTGAACAAGCATTACCTTCAGCAGAAGAACTCGATAGAXTTC
CCACGTGGAGGGATGAACAACAGAAAATTTTCACGCCCAGAGtAATGTAACTATGAGAAAAAGCATAAAAGCCAAACTAAAGCAAAACCC
GGCCTCGTGCCXGAATTCCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCNGCCACAGCGGTGGAGCTNCCAGCCAAGAAGTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan