ESTScan Details for Unigene SGN-U342189

Score 
-129
Direction 
Reverse
Predicted Peptide Sequence 
FNSGLLFKLETTLTPISVYLLIIRDFADFGLLLKNELIYKKLTRNLTNINAYNLPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKL
GNARVFPVTTL
Predicted Coding Sequence 
TTTAATAGTGGACTCTTGTTCAAACTGGAAACAACACTCACCCCTATCTCGGTCTATCTTTTGATTATAAGGGATTTTGCCGATTTCGGC
CTATTGTTAAAAAATGAGCTGATTTACAAAAAATTAACGCGAAATTTAACAAATATTAACGCTTACAATTTGCCATTCGCCATTCAGGCT
GCGCAACTGTTGGGAAGGGCGATCGGTGCGGGCCTCTTCGCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTG
GGTAACGCCAGGGTTTTCCCAGTCACGACGTTGTAA
Edits in Original Sequence 
(5')TTTAATAGTGGACTCTTGTTCAAACTGGAAACAACACTCACCCCTATCTCGGTCTATCTTTTGATTATAAGGGATTTTGCCGATTT
CGGCCTATTGTTAAAAAATGAGCTGATTTACAAAAAATTAACGCGAAATTTAACaAAATATTAACGCTTACAATTTGCCATTCGCCATTC
AGGCTGCGCAACTGTTGGGAAGGGCGATCGGTGCGGGCCTCTTCGCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCGATTA
AGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACGTTGTAA(3')AATATTTTCATGAAATGACAAGCAAAAAAGAATTAATGCTATATG
TATGGGGCATAAATAGTAGGAATATATGGAAAAAGTTAACACTAAAACC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan