ESTScan Details for Unigene SGN-U342343

Score 
282
Direction 
Forward
Predicted Peptide Sequence 
MGIAKTGQGSCWLLVYMVFLLFNLSDEFLEPSQSEAIVKIKQLLNFPQDLSSWSDNTDFCNSEPNTALTLMCYEDNITQLHISGYNWFPN
LPQGFSTDTLFSNLALLPNLKVLSLVSLGLRGTLPRKIGFLSSLEIVNISSNYLFGEIPGXDFIFEESSDTYSWIIMSLQAKFPEGEAYF
NSMPVXGVSVTKFIFWVHCLILXSNLQTRKKPFNYRVKIFLGFVPNLRKLVKSFQVPRFGKLPILAPNFPKYSNQDGYLLELKEELNSRL
GVPKKTEVPDFQIKKQEPPSNELGWDPIHPNNLFNCRLPTYSRNYAKNILTGESFQNKWAXVYSKPLPXVTYTHQTSLREEDAPDSIVPE
YSGCSNMAGFTXDKVSLQQKGDESTHPHIX
Predicted Coding Sequence 
ATGGGAATTGCAAAAACAGGGCAGGGTTCATGTTGGCTTCTTGTATACATGGTGTTTCTTCTGTTTAATTTATCAGATGAGTTCTTAGAA
CCTTCACAATCTGAAGCCATAGTGAAAATTAAGCAGCTTTTGAACTTCCCTCAAGATTTGAGTAGTTGGAGTGACAATACAGATTTTTGT
AACAGTGAGCCAAACACTGCCTTAACACTAATGTGTTATGAAGATAACATAACACAGCTTCATATTTCTGGCTATAACTGGTTCCCTAAT
TTGCCTCAGGGGTTTTCTACAGATACCCTTTTCTCTAATCTTGCTCTTTTGCCTAATTTAAAGGTGCTTTCTTTGGTTTCTTTAGGTTTG
AGAGGAACTTTACCTAGAAAGATTGGATTTTTATCTTCTTTGGAGATTGTTAATATCAGTTCAAACTATCTTTTTGGTGAGATTCCAGGA
XCAGATTTCATATTTGAAGAGTCTTCAGACACTTATAGTTGGATAATAATGAGTTTACAGGCCAAGTTTCCTGAAGGGGAGGCTTACTTT
AATTCGATGCCTGTTXTTGGAGTATCAGTAACCAAATTCATTTTCTGGGTTCATTGCCTAATACTATGATCAAATCTACAAACACGTAAG
AAACCTTTCAATTATCGGGTAAAAATTTTTCTGGGGTTTGTCCCAAACCTTCGTAAACTGGTCAAATCCTTCCAGGTTCCTCGATTTGGA
AAGTTACCAATCCTGGCACCCAATTTCCCCAAATATTCCAACCAAGATGGGTATCTTTTGGAACTTAAGGAAGAATTAAATTCAAGATTA
GGGGTACCAAAAAAAACTGAAGTTCCTGATTTTCAGATAAAAAAACAGGAACCTCCATCTAATGAGCTTGGTTGGGACCCTATTCACCCC
AACAATTTATTCAATTGCCGATTACCCACGTATTCTCGAAATTATGCGAAAAATATACTAACTGGGGAGAGCTTTCAAAATAAGTGGGCA
XTAGTATACTCAAAACCTCTACCGTAGGTGACATATACACACCAAACTTCTCTTCGTGAGGAAGATGCTCCAGATTCTATTGTACCCGAG
TATTCTGGTTGCTCAAACATGGCAGGATTTACTXCGGATAAGGTGTCACTGCAACAAAAAGGAGATGAGTCGACTCACCCTCATATCAXX
Edits in Original Sequence 
TCTGCACGAGGGAAACATAATTCTCTACTTTTTAGTGACTGTATTCTTTAAAAATGCATGCAGCTTTCTTCAACCCCAAGTATTTCTTGA
AGTTTACAGTTTTAATTCCTCAAAAAGATAAGCAAAAAAATTGCATTTGTCATGGGAATTGCAAAAACAGGGCAGGGTTCATGTTGGCTT
CTTGTATACATGGT
(5')ATGGGAATTGCAAAAACAGGGCAGGGTTCATGTTGGCTTCTTGTATACATGGTGTTTCTTCTGTTTAATTTA
TCAGATGAGTTCTTAGAACCTTCACAATCTGAAGCCATAGTGAAAATTAAGCAGCTTTTGAACTTCCCTCAAGATTTGAGTAGTTGGAGT
GACAATACAGATTTTTGTAACAGTGAGCCAAACACTGCCTTAACACTAATGTGTTATGAAGATAACATAACACAGCTTCATATTTCTGGC
TATAACTGGTTCCCTAATTTGCCTCAGGGGTTTTCTACAGATACCCTTTTCTCTAATCTTGCTCTTTTGCCTAATTTAAAGGTGCTTTCT
TTGGTTTCTTTAGGTTTGAGAGGAACTTTACCTAGAAAGATTGGATTTTTATCTTCTTTGGAGATTGTTAATATCAGTTCAAACTATCTT
TTaTGGTGAGATTCCAGGAXCAGATTTCATATTTGAAGAGTCTTCAGACACTTATAGTTGGATAATAATGAGTTTACAGGCCAAGTTTCC
TGAAGGGGtAGGCTTACTTTAATTCGATGCCTGTTXTTGGAGTATCAGTAACCAAATTCATTTTCTGGGTTCATTGCCTAATACTATGAT
CAAATCTACAAACACGTAAGAAACCTTTCAATTATCGGGTAAAAATTTTTCTGGGGTTTGTCCCAAACCTTCGTAAACTGGTCAAATCCT
TCCAGGTTCCTCGATTTGGAAAGTTACCAATCCTGGCACCCAATTTCCCCAAATATTCCAACCAAGATGGGTATCTTTTGGAACTTAAGG
AAGAATTAAATTCAAGATTAGGGGTACCAAAAAAAACTGAAGTTCCTGATTTTCAGATAAAAAAACAGGAACCTCtCATCTAATGAGCTT
GGTTGGGACCCTATTCACCCCAACAATTTATTCAATTGCCGATTACCCACGTATTCTCGAAATTATGCGAAAAATATACTAACTGGGGAG
AGCTTTCAAAATAAGTGGGCAXTAGTATACTCAAAACCTCTACCGTAGGTGACATATACACACCAAACTTCTCTTCGTGAGGAAGATGCT
cCCAGATTCTATTGTACCCGAGTATTCTGGTTGCTCAAACATGGCAGGATTTACTXCGGATAAGGTGTCACTGCAACAAAAAGGAGATGA
GTCGACTCACCCTCATATCAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan