ESTScan Details for Unigene SGN-U342517

Score 
638
Direction 
Forward
Predicted Peptide Sequence 
MDFQNLAVILAGALSPNPDERKAAEXQSQSVSAYPTTSCETAANQVDGSCDMAVRQVASIHFKNFVAKNWCPHDPAEQSKIMPSDKELVR
QNILIFIAQVPSLLRVQLGECIKTMIHADYPEQWPTLLPWIKHNLQDQQVYGALFVLRILSRKYEFKSDEERTPVYHVVEETFPHLLNIF
NKLVQITNPSIEVAXPDQAHLQNILVIHLFGDSEAVVLTQMWFNAWMVLFLNMLEKACPCGRPTS
Predicted Coding Sequence 
ATGGATTTTCAGAACCTTGCTGTCATACTTGCAGGTGCTCTAAGTCCGAATCCGGATGAACGGAAAGCTGCTGAGAAXCAGTCTCAATCA
GTTTCAGCATACCCCACAACATCTTGTGAGACTGCTGCAAATCAAGTAGATGGGTCCTGTGACATGGCAGTCCGACAGGTGGCTAGTATC
CATTTTAAGAACTTTGTTGCAAAGAACTGGTGCCCTCATGATCCTGCTGAGCAATCAAAAATTATGCCAAGTGACAAGGAATTGGTGAGG
CAAAATATTCTCATATTTATTGCACAGGTTCCTTCATTGTTGAGGGTACAGTTGGGGGAATGCATTAAAACAATGATACATGCAGACTAC
CCGGAGCAGTGGCCAACTCTTCTGCCTTGGATAAAGCATAATCTGCAGGATCAACAAGTATATGGTGCTTTGTTTGTTCTGAGAATACTC
TCGAGGAAATATGAATTCAAATCAGACGAGGAGAGAACACCTGTTTATCATGTCGTTGAGGAAACTTTTCCACATCTTCTCAACATATTC
AACAAACTTGTTCAGATAACAAATCCGTCAATTGAAGTAGCCGAXCCTGATCAAGCTCATTTGCAAAATATTCTGGTCATCCATTTATTT
GGAGATTCCGAAGCAGTTGTTTTGACCCAAATGTGGTTCAATGCCTGGATGGTTCTTTTCTTGAACATGTTGGAGAAGGCCTGTCCCTGT
GGAAGGCCAACCAGCTGA
Edits in Original Sequence 
GCACTTCTCCAATTTTTCGCTGTCTCTGTCTGCAACTTCTATTCATCCTTTCTTCTCTCTCTTTATATACATAAACTCTAGAAGAAGTCC
TTTCTTCTAGGGTTCATACAATCATTTGTTTTCATTATCCTTTTTGCTGAAAGTTGAAGTTATGGATTTTCAGAACCTTGCTGTCATACT
TGCAGGTGCTCTAAGTCCGAATCCGGATGAACGGA
(5')ATGGATTTTCAGAACCTTGCTGTCATACTTGCAGGTGCTCTAAGTCCGAAT
CCGGATGAACGGAAAGCTGCTGAGAAXCAGTCTCAATCAGTTTCAGCATACCCCACAACATCTTGTGAGACTGCTGCAAATCAtAGTAGA
TGGGTCCTGTGACATGGCAGTCCGACAGGTGGCTAGTATCCATTTTAAGAACTTTGTTGCAAAGAACTGGTGCCCTCATGATCCTGCTGA
GCAATCAAAAATTATGCCAAGTGACAAGGAATTGGTGAGGCAAAATATTCTCATATTTATTGCACAGGTTCCTTCATTGTTGAGGGTACA
GTTGGGGGAATGCATTAAAACAATGATACATGCAGACTACCCGGAGCAGTGGCCAACTCTTCTGCCTTGGATAAAGCATAATCTGCAGGA
TCAACAAGTATATGGTGCTTTGTTTGTTCTGAGAATACTCTCGAGGAAATATGAATTCAAATCAGACGAGGAGAGAACACCTGTTTATCA
TGTCGTTGAGGAAACTTTTCCACATCTTCTCAACATATTCAACAAACTTGTTCAGATAACAAATCCGTCAATTGAAGTAGCCGAXCCTGA
TCAAGCTCATTTGCAAAATATTCTGGTCATCCATTTATTTGGAGATTCCGAAGCAGTTGTTTTGACCCAAATGTGGTTCAATGCCTGGAT
GGTTCTTTTCTTGAACATGTTGGAGAAGGCCTGTCCCTGTGGAAGGCCAACCAGCTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan