ESTScan Details for Unigene SGN-U342595

Score 
288
Direction 
Forward
Predicted Peptide Sequence 
KLELPAVAAALELVDPRAAGIRHEGGRTVITTIHQPSSRLYYMFDKVVLLSEGCPIYYGPASTALEYFSSIGFSISITINPADLLLDLAN
GIGSDTKNGNDQGDSTEQEKKLVREALISAYEMNISTRLKTEDAVTTVAQMMSLQEMAEIRAMVHELDASIQSTTYERVKGAKTRAFNRL
RIFQVISVAFLAGLLWWHTPTSHIEDRIAMLFFFAVFWGFYPLYNAVFTFPQXKKNAHQREIIXNVSSLVILPSQNCXRFAFRTALPTAF
TFIPYWMGXLKPDPTTFILSXPSSPLQRPRFX
Predicted Coding Sequence 
XATAAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCGGGCTGCAGGAATTCGGCACGAGGGTGGTCGTACTGTG
ATCACAACGATCCATCAGCCGTCTAGTCGACTTTATTATATGTTTGATAAGGTAGTTTTGCTCTCTGAGGGATGTCCTATCTACTATGGT
CCTGCATCAACTGCCTTGGAGTACTTCTCTTCTATTGGTTTTTCCATATCTATCACTATCAATCCAGCTGATCTCTTGCTCGATCTCGCG
AATGGGATTGGATCTGATACCAAGAATGGCAACGATCAAGGTGACAGTACTGAACAGGAAAAGAAGTTGGTGAGAGAAGCTCTCATCTCC
GCGTATGAAATGAACATTTCTACAAGGTTGAAAACTGAAGATGCGGTAACTACAGTTGCACAAATGATGTCTCTACAAGAAATGGCTGAA
ATTAGAGCAATGGTGCACGAGTTGGATGCATCAATTCAAAGTACTACTTATGAGAGGGTTAAGGGAGCGAAGACACGAGCCTTCAATAGG
CTTAGGATCTTCCAAGTTATAAGTGTAGCATTTCTTGCAGGACTATTGTGGTGGCATACTCCAACATCCCACATTGAAGATCGAATTGCA
ATGTTGTTCTTTTTCGCGGTATTTTGGGGGTTCTATCCACTCTATAATGCAGTTTTCACATTTCCACAAGAXAAGAAGAATGCTCATCAA
AGAGAGATCATCANGAATGTATCGTCTCTCGTCATACTTCCTAGCCAAAACTGTANGAGATTTGCCTTTAGAACAGCATTACCNACAGCA
TTTACGTTCATCCCTTACTGGATGGGANGGCTCAAACCTGATCCAACTACTTTCATCCTATCTXCTCCTAGTAGTCCTCTACAACGTCCT
CGTTTCAAX
Edits in Original Sequence 
(5')XATAAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATcCCCCGGGCTGCAGGAATTCGGCACGAGGGTGGTCGTA
CTGTGATCACAACGATCCATCAGCCGTCTAGTCGACTTTATTATATGTTTGATAAGGTAGTTTTGCTCTCTGAGGGATGTCCTATCTACT
ATGGTCCTGCATCAACTGCCTTGGAGTACTTCTCTTCTATTGGTTTTTCCATATCTATCACTATCAATCCAGCTGATCTCTTGCTCGATC
TCGCGAATGGGATTGGATCTGATACCAAGAATGGCAACGATCAAGGTGACAGTACTGAACAGGAAAAGAAGTTGGTGAGAGAAGCTCTCA
TCTCCGCGTATGAAATGAACATTTCTACAAGGTTGAAAACTGAAGtATGCGGTAACTACAGTTGCACAAATGATGTCTCTACAAGAAATG
GCgTGAAATTAGAGCAATGGTGCACGAGTTGGATGCATCAATTCAAAGTACTACTTATGAGAGGGTTAAGGGAGCGAAGACACGAGaCCT
TCAATAGGCTTAGGATCTTCCAAGTTATAAGTGTAGCATTTCTTGCAGGACTATTGTGGTGGCATACTCCAACATCCCACATTGAAGATC
GAATTGCAATGTTGTTCTTTTTCGCGGTATTTTGGGGGTTCTATCCACTCTATAATGCAGTTTTCACATTTCCACAAGAXAAGAAGAATG
CTCATCAAAGAGAGATCATCANGAATGTATCGTCTCTCGTCATACTTCCTAGCCAAAACTGTANGAGATTTGCCTTTAGAACtAGCATTA
CCNACAGCATTTACGTTCATCCCTTACTGGATGGGANGGCTCAAACCTGATCCAACTACTTTCATCCTATCTXCTCCTAGTAGTCCTCTA
CAACGTCCTCGTTTCAAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan