ESTScan Details for Unigene SGN-U342596

Score 
180
Direction 
Forward
Predicted Peptide Sequence 
DSLSKELKAQRLFLKLLEAILKAGNRMNAGTSRGNAQAFKLTALRKLSDVKSMDGKTTLLYFVVQEVVRAEGKRCVLNRNQSLRRSNSQT
TASSAIPTSKNTTENDETDKEYMMLGLPIVGGLSSAFSNVKKAAAIDYDLLSKTCSMLTAQISEIKTHLAQRDNVKGLFGKEMKKFLDAA
XKRNXKPVRDEQHRLMELVKKTTDYYPARASHDTGWQPLSLFAIVKDFLDMVDKSAVENTHNMPTKEPPEAVAGSSPPGMKIVKLPNFNI
ACYFLSNFSKAIRLLYYHDXLNSNKEIHGPNSRPXKENTRFLMVPIVSNDSLLRKNNNPHFRLTQSCGEPTPPQPALNPRAX
Predicted Coding Sequence 
XXAGATTCGCTTAGCAAGGAGCTTAAAGCTCAAAGATTGTTCTTGAAACTTCTAGAAGCTATTTTGAAAGCGGGGAATAGAATGAATGCC
GGAACTTCAAGAGGAAACGCACAAGCGTTTAAACTTACTGCTCTCAGAAAACTGTCTGATGTGAAAAGTATGGATGGTAAGACCACATTA
CTTTACTTTGTTGTGCAAGAAGTAGTCAGAGCAGAAGGAAAACGTTGCGTTCTAAATCGTAATCAAAGTTTAAGGCGTAGCAATAGCCAG
ACTACTGCGAGCAGCGCCATTCCGACATCAAAGAACACTACAGAAAATGATGAGACCGACAAGGAGTATATGATGCTTGGCTTACCAATA
GTGGGTGGATTAAGTTCTGCATTTAGTAATGTAAAGAAAGCAGCTGCAATAGACTATGACTTGCTGTCCAAGACGTGCTCGATGCTAACA
GCTCAGATATCTGAAATAAAGACACATTTGGCACAACGCGACAATGTTAAAGGACTATTCGGTAAAGAGATGAAGAAATTCCTGGATGCT
GCTXTGAAAAGAAATGXAAAACCAGTGAGAGACGAACAACATAGACTAATGGAACTCGTGAAGAAAACCACCGATTATTATCCAGCACGA
GCTTCACATGATACAGGATGGCAACCCCTTTCACTATTCGCCATAGTTAAAGATTTCCTAGACATGGTTGATAAGTCTGCXGTAGAGAAC
ACACACAACATGCCTACAAAAGAACCCCCTGAAGCTGTTGCAGGATCCTCTCCCCCCGGAATGAAAATAGTAAAGCTGCCAAATTTCAAC
ATTGCCTGTTACTTTCTATCAAACTTTTCCAAAGCCATTCGTCTTCTATACTACCATGATXTCCTGAATTCCAACAAAGAAATCCACGGG
CCTAATTCCCGTCCTGAXAAGGAAAATACACGTTTTTTAATGGTCCCCATTGTTTCCAATGATTCACTTTTGCGAAAGAACAACAACCCT
CATTTCCGCCTCACACAATCCTGCGGAGAGCCCACACCTCCTCAACCCGCCTTAAACCCTCGCGCTCXX
Edits in Original Sequence 
(5')XXAGATTCGCTTAGCAAGGAGCTTAAAGCTCAAAGATTGTTCTTGAAACTTCTAGAAGCTATTTTGAAAGCGGGGAATAGAATGAA
TGCCGGAACTTCAAGAGGAAACGCACAAGCGTTTAAACTTACTGCTCTCAGAAAACTGTCTGATGTGAAAAGTATGGATGGTAAGACCAC
ATTACTTTACTTTGTTGTGCAAGAAGTAGTCAGAGCAGAAGGAAAACGTTGCGTTCTAAATCGTAATCAAAGTTTAAGGCGTAGCAATAG
CCAGACTACTGCGAGCAGCGCCATTCCGACATCAAAGAACACTACAGAAAATGATGAGACCGACAAGGAGTATATGATGCTTGGCTTACC
AATAGTGGGTGGATTAAGTTCTGCATTTAGTAATGTAAAGAAAGCAGCTGCAATAGACTATGACTTGCTGTCCAAGACGTGCTCGATGCT
AACAGCTCAGATATCTGAAATAAAGACACATTTGGCACAACGCGACAATGTTAAAGGACTATTCGGTAAAGAGATGAAGAAATTCCTGGA
TGCTGCTXTGAAAAGAAATGXAAAACCAGTGAGAGACGAACAACATAGACTAATGGAACTCGTGAAGAAAACCACCGATTATTATCCAGC
ACGAGCTTCACATGATACAGGATGGCAACCCCTTTCACTATTCGCCATAGTTAAAGATTTCCTAGACATGGTTGATaAAGTCTGCXGTAG
AGAACACACACAACATGCCTACAAAAGAAcCCCCCTGAAGCTGTTGCAGGATCCTCTCCCCCCGGAATGAAAATAGTAAAGCTGCCAAAT
TTCAACATTGCCTGTTACTTTCTATCAAACTTTTCCAAAGCCATTCGTCTTCTATACTACCATGATXTCCTGAATTCCAACAAAGAAATC
CACGGGCCTAATTCCCGTCCTGAXAAGGAAAATACACGTTTTTTAATGGTCCCCATTGTTTCCAATGATTCACTTTTGCGAAAGAACAcA
CAACCCTCATTTCCGCCTCACACAATCCTGCGGAGAGCCCACACCTCCTCAACCCGCCTTAAACCCTCGCGCTCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan