ESTScan Details for Unigene SGN-U342656

Score 
477
Direction 
Forward
Predicted Peptide Sequence 
AGAPRGGGRSRTSGSPGLQEFGTRLLLSXTINFSHNQQSFCFLVKHSYFFAFAVGKKEITNLYKPFLHSSLQLYDNNDTILSSASSAEHY
FSVHAILDPIDFLALQAIRKGLDDLPGSNYFASWDFTSEPCNFAGVYCDGDKVIALNLGDPRAGAPGLTGNLDPSIGKLSALAGVHGGSG
SETGPLPESFSQLKKLRFLGVSRNFLSGDIPASLGLLRELQTLDLSFNQLTGSIPWAIGAXSGIVQHYTVSQPLVRYDPTLRIPRFDRLD
LKHTTFKYPFARIISXIXLILX
Predicted Coding Sequence 
XXAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGCTTCTTCTCTCCTAA
ACCATTAATTTCAGCCATAACCAACAAAGCTTTTGCTTTCTTGTGAAGCATTCCTACTTTTTTGCCTTTGCTGTTGGCAAAAAAGAAATA
ACCAACTTATATAAGCCTTTCCTTCATTCTTCTCTTCAGCTATACGATAATAATGATACCATTCTTTCTTCTGCTTCTTCTGCAGAGCAC
TATTTCTCTGTACATGCCATTTTAGACCCAATTGATTTCTTAGCTTTACAAGCGATTCGAAAAGGCTTGGATGATTTGCCCGGTTCCAAC
TATTTTGCTTCCTGGGATTTCACTTCGGAGCCCTGTAACTTCGCCGGAGTTTACTGCGATGGAGATAAAGTGATCGCCTTGAATCTCGGT
GATCCCAGAGCCGGAGCACCAGGGTTAACTGGAAACTTGGATCCTTCTATTGGAAAACTCTCTGCTCTTGCXGGAGTTCACGGTGGTTCC
GGGTCGGAAACTGGTCCATTGCCCGAAAGTTTTTCTCAGTTGAAGAAGCTGAGATTTCTAGGAGTTAGCCGGAACTTTCTCTCCGGTGAT
ATTCCGGCGTCATTAGGCCTTCTCCGGGAGCTACAAACTCTTGATCTTAGTTTCAATCAGCTGACCGGGAGCATCCCTTGGGCTATTGGA
GCTXCTTCCGGCATTGTCCAACATTATACTGTGTCACAACCACTTGTCCGGTACGATCCCACCCTTCGTATCCCAAGATTTGACCGTTTA
GACCTTAAACACACCACTTTCAAGTACCCTTTTGCCCGAATCATTTCCNTCATCGNNCTCATACTTNXX
Edits in Original Sequence 
(5')XXAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGCTTCTTCTCTC
CTAAACCATTAATTTCAGCCATAACCAACAAAGCTTTTGCTTTCTTGTGAAGCATTCCTACTTTTTTGCCTTTGCTGTTGGCAAAAAAGA
AATAACCAACTTATATAAGCCTTTCCTaTCATTCTTCTCTTCAGCTATACGATAATAATGATACCATTCTTTCTTCTGCTTCTTCTGCAG
AGCACTAgTTTCTCTGTACATGCCATTTTAGACCCAATTGATTTCTTAGCTTTACAAGCGATTCGAAAAGGCTTGGATGATTTGCCCGGT
TCCAACTATTTTGCTTCCTGGGATTTCACTTCGGAGCCCTGTAACTTCGCCGGAGTTTACTGCGATGGAGATAAAGTGATCGCCTTGAAT
CTCGGTGATCCCAGAGCCGGAGCACCAGGGTTAACTGGAAACTTGGATCCTTCTATTGGAAAACTCTCTGCTCTTGCXGGAGTTCACGGT
GGTTCCGGGTCGGAtAACTGGTCCATTGCCCGAAAGTTTTTCTCAGTTGAAGAAGCTGAGATTTCTAGGAGTTAGCCGGAACTTTCTCTC
CGGTGATATTCCGGCGTCATTAGGCCTTCTCCGGGAGCTACAAACTCTTGATCTTAGTTTCAATCAGCTGACCGGGAGCATCCCTTGGGC
TATTGGAGCTXCTTCCGGCATTGTCCAACATTATACTGTGTCACAACCACTTGTCCGGTACGATCCCACCCTTCGTATCCCAAGATTTGA
CCGTTTAGACCTTAAACACACgCACTTTCAAGTACCCTTTTGCCCGAATCATTTCCNTCATCGNNCTCATACTTNXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan