ESTScan Details for Unigene SGN-U342780

Score 
171
Direction 
Forward
Predicted Peptide Sequence 
LXTYAGAHRGGGRSRTSGSPGLQEFGTRLDQVEKIDVSTNKLNGTIPNELCELPLESLNLFENQFEGLIPESIANSPNLYELKLFSNRFS
GSLPSELGKNSALQYLDVSYNTFSGKIPESLCEIGALEDLIVIYNSFSGNIPAVLATAGVYLGSGSGXNKLFGEVPTDXWSLPHVYLLDL
FGNAFSGNISHMISGAKNYLTFKFQETNSSGVIPSEVGKLKNLIEFSASHNELTGELSDTLVQLGAVGTLDLSSMSX
Predicted Coding Sequence 
TTGAANACATATGCTGGAGCTCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACCAGACTTGAC
CAGGTTGAGAAGATTGATGTATCGACTAACAAGTTAAATGGGACTATTCCTAATGAGTTGTGTGAGCTGCCACTTGAGTCACTCAATCTA
TTTGAGAATCAATTTGAGGGGCTTATTCCAGAAAGTATAGCTAACTCTCCGAATCTGTATGAGCTGAAGTTATTCTCTAACAGATTTTCT
GGTTCATTGCCTAGTGAACTGGGGAAGAACTCGGCTTTACAGTATCTTGATGTTTCATACAATACATTTTCTGGTAAAATTCCTGAAAGT
TTATGTGAGATTGGAGCTTTAGAGGATCTTATAGTTATATATAATTCGTTCTCTGGGAATATTCCGGCCGTCTTGGCAACTGCCGGAGTT
TACTTAGGATCAGGTTCCGGTXCTAATAAGCTATTCGGGGAAGTCCCAACTGACTNTTGGAGTTTGCCTCATGTTTATCTCTTGGACCTT
TTTGGCAATGCATTTTCAGGAAATATATCACACATGATTTCTGGTGCCAAAAATTATCTAACCTTCAAATTTCAAGAAACAAATTCXTCA
GGGGTTATACCTAGTGAAGTAGGAAAGTTGAAGAACTTAATTGAATTTTCCGCGAGTCATAATGAGCTAACCGGAGAACTTTCAGACACA
TTAGTGCAGTTAGGGGCAGTTGGAACCCTGGATCTTAGTTCAATGAGCCAX
Edits in Original Sequence 
(5')TTGAANACATATGCTGGAGCTcCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACCAGAC
TTGACCAGGTTGAGAAGATTcGATGTATCGACTAACAAGTTAAATGGGACTATTCCTAATGAGTTGTGTGAGCTGCCACTTGAGTCACTC
AATCTATTTGAGAATCAATTTGAGGGGCTTATTCCAGAAAGTATAGCTAACTCTCCGAATCTGTATGAGCTGAAGTTATTCTCTAACAGA
TTTTCTGGTTCATTGCCTAGTGAACTGGGGAAGAACTCGGCTTTACAGTATCTTGATGTTTCATACAATACATTTTCTGGTAAAATTCCT
GAAAGTTTATGTGAGATTGGAGCTTTAGAGGATCTTATAGTTATATATAATTCGTTCTCTGGGAATATTCCGGCCaGTCTTGGCAACTGC
CGGAGTTTACTTAGGATCAGGTTCCGGTXCTAATAAGCTATTCGGGGAAGTCCCAACTGACTNTTGGAGTTTGCCTCATGTTTATCTCTT
GGACCTTTTTGGCAATGCATTTTCAGGAAATATATCACACATGATTTCTGGTGCCAAAAATTaATCTAACCTTCAAATTTCAAGAAACAA
ATTCXTCAGGGGTTATACCTAGTGAAGTAGGAAAGTTGAAGAACTTAATTGAATTTTCCGCGAGTCATAATGAGCTAACCGGAGAACTTT
CAGACACATTAGTGCAGTTAGGGGCAGTTaGGAACCCTGGATCTTAGTTCAATGAGCCAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan