ESTScan Details for Unigene SGN-U342807

Score 
191
Direction 
Reverse
Predicted Peptide Sequence 
MEPKAKNLPVGGNVNPVEIVSKLKNLCPPKIVLVGPPKKPEKKKNIYPNNQKXQKKPAAIKAYPAPVLYQYQNQPPYPQCPTPVPAYQPY
YSVEKDPNSW
Predicted Coding Sequence 
ATGGAACCCAAGGCCAAGAATTTGCCCGTAGGCGGAAATGTAAACCCCGTTGAAATAGTTTCAAAATTAAAGAACCTGTGTCCCCCTAAA
ATAGTATTGGTTGGGCCACCAAAAAAGCCGGAGAAAAAGAAAAATATTTACCCGAATAACCAGAAGXACCAAAAGAAACCGGCAGCGATA
AAGGCATATCCAGCTCCGGTTCTCTATCAATATCAAAATCAACCACCTTATCCCCAGTGCCCAACCCCTGTTCCTGCTTATCAGCCCTAT
TACAGTGTGGAAAAGGACCCCAACTCTTGG
Edits in Original Sequence 
AAGAAACCGGCAGCGATAAAGGCATATCCAGCTCCGGTTCTCTATCAATATCAAAATCAACCACCTTATCCCCAGTGCCCAACCCCTGTT
CCTGCTTATCAGCCCTATTACAGTGTGGAAAAGGACCCCAACTCTTGGGTGATCTGCTAGCTTCCCATTTGTGATGAGTTAG
(5')ATGG
AACCCAAGGCCAAGAATTTGCCCGTAGGCGGAAATGTAAACCCCGTTGAAATAGTTTCAAAATTAAAGAACCTGTGTCCCCCTAAAATAG
TATTGGTTGGGCCACCAAAAAAGCCGGAGAAAAAGAAAAATATTTAcCCCGAATAACCAGAAGXACCAAAAGAAACCGGCAGCGATAAAG
GCATATCCAGCTCCGGTTCTCTATCAATATCAAAATCAACCACCTTATCCCCAGTGCCCAACCCCTGTTCCTGCTTATCAGCCCTATTAC
AGTGTGGAAAAGGACCCCAACTCTTGG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan