ESTScan Details for Unigene SGN-U342832

Score 
-113
Direction 
Forward
Predicted Peptide Sequence 
RRVXLXRXFRLSVXASADXESRPELADVLELADSPDCMNSVRGVGRSALSILLPVPDELKLQALDLSEYCDPRRLRFCFRVVIFCFKVSC
QVXVEVVALNARMEGNKDEALRCIGIAKEAIASGNKQKALKFIRIARRLNNDLSVEDLLAACENLESPTPESSSEVRNVENKKNDRVAVK
SDEVSDGERNYTDEHVQLIRQIRIKKDYYANLGHRKGVPVMKKGILHETXLGKVIRTKKAQALESLLKNCKAFKGLRDKNQEAFYPTGWL
RIPG
Predicted Coding Sequence 
AGGAGAGTCCNGCTNNNNCGGANTTTCAGGTTGTCAGTGANNGCTTCAGCTGATCANGAGAGCCGNCCCGAGTTGGCGGACGTTCTAGAA
CTAGCGGATTCCCCGGACTGTATGAATTCGGTACGAGGTGTCGGTCGGTCGGCTCTTTCTATTTTACTTCCGGTACCAGATGAATTGAAA
TTGCAAGCGCTTGATCTCTCTGAGTATTGTGACCCTAGAAGATTGCGTTTTTGTTTCAGAGTTGTGATTTTCTGTTTTAAAGTTTCTTGT
CAAGTTGXAGTTGAAGTTGTTGCATTGAACGCTAGAATGGAAGGTAACAAGGATGAGGCTTTAAGGTGCATTGGTATTGCCAAGGAGGCA
ATTGCATCTGGCAATAAGCAGAAAGCACTCAAGTTTATCAGAATTGCACGGCGCCTTAACAATGATCTATCTGTGGAAGATCTTTTGGCT
GCATGTGAAAATCTGGAGTCACCGACTCCTGAGTCCTCAAGTGAAGTTAGAAATGTTGAAAATAAGAAAAATGACAGAGTCGCXGTTAAG
TCTGATGAGGTATCCGATGGGGAGAGGAACTATACTGACGAACATGTGCAGTTGATTAGGCAAATTAGGATTAAGAAGGACTATTACGCG
AATCTTGGTCATAGAAAGGGTGTTCCAGTGATGAAGAAAGGAATCCTACATGAAACTGXTCTTGGAAAGGTTATCCGGACAAAAAAAGCT
CAGGCTCTTGAAAGCCTTTTAAAAAATTGCAAGGCATTTAAAGGXTTGAGGGATAAGAATCAGGAGGCGTTTTACCCAACGGGTTGGCTG
AGGATTCCGGGTTAA
Edits in Original Sequence 
(5')AGGAGAGTCCNGCTNNNNCGGANTTTCAGGTTGTCAGTGANNGCTTCAGCTGATCANGtAGAGCCGNCCCGAGTTGGCGGACGTTC
TAGAACTAGCGGATTCCCCGGACTGTATGAATTCGGTACGAGGTGTCGGTCGGTCGGCTCTTTCTATTTTACTTCCGGTACCAGATGAAT
TGAAATTGCAAGCGCTTGtATCTCTCTGAGTATTGTGACCtCTAGAAGATTGCGTTTTTGTTTCAGAGTTGTGATTTTCTGTTTTAAAGT
TTCTTGTCAAGTTGXAGTTGAAGTTGTTGCATTGAACGCTAGAATGGAAGGTAACAAGGATGAGGCTTTAAGGTGCATTGGTATTGCCAA
GGAGGCAATTGCATCTGGCAATAAGCAGAAAGCACTCAAGTTTATCAGAATTGCACGGCGCCTTAACAATGATCTATCTGTGGAAGATCT
TTTGGCTGCATGTGAAAATCTGGAGTCACCGACTCCTGAGTCCTCAAGTGAAGTTAGAAATGTTGAAAATAAGAAAAATGACAcGAGTCG
CXGTTAAGTCTGATGAGGTATCCGATGGGGAGAGGAACTATACTGACGAACATGTGCAGTTGATTAGGCAAATTAGGATTAAGAAGGACT
ATTACGCGAATCTTGGTCtATAGAAAGGGTGTTCCAGTGATGAAGAAtAGGAATCCTACATGAAACTGXTCTTGGAAAGGTTATCCGGAC
AAAAAtAAGCTCAGGCTCTTGAAAGCCTTTTAAAAAATTGCAAGGCATTTAAAGGXTTGAGGGATAAGAATCAGGAGGCGTTTTACCCAA
CGGGTTGGCTGAGGATTCCGGGTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan