ESTScan Details for Unigene SGN-U342897

Score 
338
Direction 
Forward
Predicted Peptide Sequence 
EGXKXXXXPXRXXPTXYVCTGKVGDPCGGCRSRTSGSPGLQEFGTRLKIYHQMDDLGTPRSAISFNXAFISLRGSKLYDRVPQLFDEIPV
KYRFLPDKVSYGILIRSYCETGLPEMAMEILKVMEEKSVEITTVTFTTILHSFYKKGKSDEAEKVWNEMVNRGCGPDVGAYNVKIMNIQG
GDLEGVKALIEEMNDAGLKPDTISYNYLMTCYCKNELMDEAQMVYDDLEKNGCNPNAATFRTLIFYLCKKGRYETGYKVFKESVKIQKIP
GFGTFKFLVERVVKKIKVXKMQKG
Predicted Coding Sequence 
XTGGAGGGTNTNAAGGXNNNNNNNGNCCCNNNNAGGNNNNGGCCTACGAANTACGTATGCACGGGAAAAGTAGGAGATCCATGCGGTGGC
TGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGCTCAAAATTTATCATCAGATGGATGATTTAGGCACCCCC
AGATCAGCTATTTCCTTCAATGXTGCTTTTATCAGCTTGCGTGGCTCAAAACTATATGATCGTGTCCCCCAGCTGTTTGATGAAATTCCA
GTGAAGTATAGATTTTTACCTGATAAAGTGTCGTACGGTATACTGATTAGGTCATATTGTGAAACGGGGTTGCCGGAAATGGCAATGGAA
ATACTCAAGGTGATGGAGGAGAAAAGTGTGGAGATTACAACGGTTACTTTCACTACTATACTACATTCATTCTACAAGAAAGGGAAGAGT
GATGAGGCGGAGAAGGTATGGAATGAGATGGTGAACAGAGGGTGTGGTCCAGATGTTGGTGCATACAATGTGAAGATTATGAACATTCAG
GGGGGTGATCTGGAGGGCGTGAAAGCTTTAATTGAGGAAATGAACGATGCTGGATTGAAACCTGATACGATTAGCTACAATTATTTGATG
ACTTGTTATTGTAAGAATGAATTGATGGACGAGGCACAGATGGTTTATGATGATCTGGAGAAAAATGGGTGTAATCCAAATGCTGCAACT
TTTAGGACTTTAATCTTTTATTTGTGTAAGAAAGGAAGGTATGAGACTGGTTACAAGGTGTTCAAGGAGAGTGTGAAAATTCAAAAGATC
CCCGGATTTGGTACCTTCAAGTTTTTGGTGGAAAGGGTGGTGAAAAAAATCAAAGTTGAXAAGATGCAAAAGGGTTAA
Edits in Original Sequence 
(5')XTGGAGGGTNTNAAGGXNNNNNNNGNCCCNNNNAGGNNNNGGCCTACGAANTACGTATGCACGGGAAAAGTAGGAGATCCATGCGG
TGGCTGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGCTCAAAATTTATCATCAGATGGATGATTTAGGCAC
CCCCAGATCAGCTATTTCCTTCAATGXTGCTTTTATCAGCTTGCGTGcGCTCAAAACTATATGATCGTGTCCCCCAGCTGTTTGATGAAA
TTCCAGTGAAGTATAGATTTTTACCTGATAAAGTGTCGTACGGTATACTGATTAGGTCATATTGTGAAACGGGGTTGCCGGAAATGGCAA
TGGAAATACTCAAGGTGATGGAGGAGAAAAGTGTGGAGATTACAACGGTTACTTTCACTACTATACTACATTCATTCTACAAGAAAGGGA
AGAGTGATGAGGCGGAGAAGGTATGGAATGAGATGGTGAACAGAGGGTGTGGTCCAGATGTTGGTGCATACAATGTGAAGATTATGAACA
TTCAGGGGGGTGATCTGGAGGGCGTGAAAGCTTTAATTGAGGAAATGAACGATGCTGGATTGAAACCTGATACGATTAGCTACAATTATT
TGATGACTTGTTATTGTAAGAATGAATTGATGGACGAGGCACAGATGGTTTATGATGATCTGGAGAAAAATGGGTGTAATCCAAATGCTG
CAACTTTTAGGACTTTAATCTTTTATTTGTGTAAGAAAGGAAGGTATGAGACTGGTTACAAGGTGTTCAAGGAGAGTGTGAAAATTCAAA
AGATCCCCGGATTTGGTACCTTCAAGTTTTTGGTGGAAAGGGTGGTGAAAAAAATCAAAGTTGAXAAGATGCAAAAGGGTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan