ESTScan Details for Unigene SGN-U342908

Score 
-359
Direction 
Reverse
Predicted Peptide Sequence 
GRPGNNPPLWGGIVSPLFGRHWAPKNYGFFWGPFDFGSPTVPLNPGPRVSKIGKTNXNPILGWILLDIKRDLSDXKANWLNNELIYQTFF
AYFXPNIAAFKMPFPIQPVQHLDRWIDADLFDIEPAGERGMCCKAIKLGNATVFPVTTLYNDGQVLAPPRYRVNWVPGPPSRAGTDGYEX
HHVLAGTDRYSDISEKYQCKLQHENLKNRDVSNVISYLKSLSFHQLKHDENYPITSXSMNVDPNQKDITPWSLPVPNVEVLVETQLKLLS
VSDVANFRVNAVEALYAAHESIVFNNSKRITSHAACSRARTVLFWVSVPDVRXDPSSQGTIVRLRDALARXPYFLKGFGIPQPGDPPV
Predicted Coding Sequence 
XTTGGACGCCCCGGAAATAACCCCCCTTTATGGGGGGGGATTGTTTCCCCCCTTTTTGGGCGCCATTGGGCCCCCAAAAATTACGGGTTT
TTTTGGGGCCCTTTTGATTTTGGAAGTCCCACGGTTCCTTTAAACCCGGGACCTCGGGTTTCCAAAATTGGAAAAACCAATGXAAACCCT
ATCCTAGGTTGGATTCTTTTGGATATAAAAAGGGATTTATCTGATXTTAAAGCTAATTGGTTAAATAATGAGCTGATTTACCAAACATTT
TTCGCGTATTTCAAXCCAAATATTGCCGCTTTCAAGATGCCATTTCCCATTCAGCCTGTTCAACATTTGGACAGGTGGATCGATGCGGAC
CTCTTCGATATTGAGCCAGCTGGGGAAAGGGGGATGTGTTGCAAGGCGATTAAGTTGGGTAACGCCACAGTTTTCCCAGTCACGACTTTG
TATAACGACGGCCAGGTACTTGCACCCCCTCGATATAGGGTGAATTGGGTTCCGGGCCCCCCCTCGAGGGCAGGGACTGATGGTTATGAA
XATCATCATGTATTGGCAGGGACTGATAGGTATTCAGACATATCAGAGAAATATCAATGTAAGTTGCAACATGAAAATTTAAAAAATAGG
GATGTTTCGAACGTTATATCATATCTTAAAAGTTTGTCATTCCATCAGTTAAAACATGATGAAAATTATCCCATTACTTCAXTTTCCATG
AATGTAGACCCAAATCAAAAGGATATAACGCCATGGTCTTTACCAGTACCAAATGTAGAGGTCCTGGTAGAAACTCAACTCAAGCTTTTA
TCGGTAAGCGATGTAGCCAATTTCCGAGTCAATGCTGTGGAAGCATTGTATGCAGCACACGAGTCCATAGTTTTTAATAATAGCAAGAGG
ATTACCTCACACGCGGCATGTTCGAGAGCCAGGACCGTACTTTTTTGGGTGAGCGTTCCAGATGTTAGAGXTGACCCATCTTCCCAAGGC
ACCATAGTAAGGCTGCGTGATGCGTTAGCCAGACANCCCTACTTCTTAAAAGGGTTCGGAATTCCGCAGCCCGGGGATCCTCCAGTNTGA
Edits in Original Sequence 
(5')XTTGGACGCCCCGGAAATAACCCCCCTTTATaGGGGGGGGATTGTTTCCCCCCTTTTTGGGCGCCATTGGGCCCCCAAAAATTACG
GGTTTTTTTGGGGCCCTTTTGATTTTGGAAGTCCCACGGTTCCTTTAAACCCGGGACCTCGGGTTTCCAAAATTGGAAAAACCAATGXAA
ACCCTATCCTAGGTTGGATTCTTTTGGATATAAAAAGGGATTTATCTGATXTTAAAGCTAATTGGTTAAATAATGAGCTGATTTACCAAA
CATTTTTCGCGTATTTCAAXCCAAATATTGCCGCTTTCAAGATGCCATTTCCCATTCAGCCTGTTCAACATTTGGACAGGTGGATCGATG
CGGACCTCTTCGATATTGAGCCAGCTGGGGAAAGGGGGATGTGTTGCAAGGCGATTAAGTTGGGTAACGCCACAGTTTTCCCAGTCACGA
CTTTGTATAACGACGGCCAGGTACTTGtCACCCCCTCGATATAGGGTGAATTGGGTTCCGGGCCCCCCCTCGAGGGCAGGGACTGATaGG
TTATGAAXATCATCATGTATTGGCAGGGACTGATAGGTATTCAGACATATCAGAGAAATATCAATGTAAGTTGCAACATGAAAATTTAAA
AAATAGGGATGTTTCGAACGTTATATCATATCTTAAAAGTTTGTCATTCCATCAGTTAAAACATGaATGAAAATTATCCCATTACTTCAX
TTTCCATGAATGTAGACCCAAATCAAAAGGATATAACGCCATaGGTCTTTACCAGTACCAAATGTAGAGGTCCTGGTAGAAACTCAtACT
CAAGCTTTTATCGGTAAGCGATGTAGCCAATTTCCGAGTCAATGCTGTGGAAGCATTGTATGCAGCACACGAGTCCATAGTTTTTAATAA
TAGCAAGAGGATTACCTCACACGCGGCATGTTCGAGAGCCAGGACCGTACTTTTTTGGGTGAGCGTTCCAGATGTTAGAGXTGACCCATC
TTCCCAAGGCACCATAGTAAGGCTGCGTGATGCGTTAGCCAGACANCCCTACTTCTTAAAAGGGTTCGGAATTCCGCAGCCCGGGGATCC
TCCAGTNTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan