ESTScan Details for Unigene SGN-U342914

Score 
81
Direction 
Forward
Predicted Peptide Sequence 
MKPTYISSNTSLVWFSHLSHRKNKEAKLESCPHSDGSLIQLLHLFSQVGSTSVDLQARELQLLFPLVRVNFELGVIKVIAVSCVKIVSAX
QFHTIYEPES
Predicted Coding Sequence 
ATGAAGCCAACTTACATATCATCAAACACCAGTCTTGTTTGGTTTTCACATCTATCACATAGAAAGAATAAAGAAGCTAAGCTTGAATCT
TGTCCTCATTCGGATGGATCGCTCATACAACTTCTGCACCTCTTCTCTCAAGTTGGATCCACTAGTGTCGACCTGCAGGCGCGCGAGCTC
CAGCTTTTGTTCCCTTTAGTGAGGGTTAATTTCGAGCTTGGCGTAATCAAGGTCATAGCTGTTTCCTGTGTGAAAATTGTATCCGCTCXA
CAATTCCACACAATATACGAGCCGGAAAGTTAA
Edits in Original Sequence 
GGGGGAAAAAAAACTGACTCATACACATGGACTACTTGCCCATGTCTTTTTATATAATACACACACGTTGACGCCAGATTTTGTGCCAAA
CAATGACCACTAATTTAATGATTCTCACGTTTATATAACATGAAGCCAACTTACATATCATCAAACACCAGTCTTGTTTGGTTTTCACAT
CTATCACATAGAAAGAATATAAGAAGCTAAGCTTGAATCTTGTCCTCATTCGGATGGATCGCTCATACAAC
(5')ATGAAGCCAACTTAC
ATATCATCAAACACCAGTCTTGTTTGGTTTTCACATCTATCACATAGAAAGAATAtAAGAAGCTAAGCTTGAATCTTGTCCTCATTCGGA
TGGATCGCTCATACAACTTCTGCACCTCTTCTCTCAAGTTGGATCCACTAGTGTCGACCTGCAGGCGCGCGAGCTCCAGCTTTTGTTCCC
TTTAGTGAGGGTTAATTTCGAGCTTGGCGTAATCAAGGTCATAGCTGTTTCCTGTGTGAAAATTGTATCCGCTCXACAATTCCACACAAT
ATACGAGCCGGAAAGTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan