Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U342960

Score 
-74
Direction 
Reverse
Predicted Peptide Sequence 
GIPPDLGDNPYFRPLSEADTVCPTRRTEGSESVSEEAEERPITKPAFPRAVGRFINAAGTTGFPTGKRAVSATQLMELAHSLGTPGFTLY
ASGRMLCGIVTDNNFTQETAMTMITPSSKLTLTKGNKSWSSTAVAAAXRTSGSPGLQEFGTRGEGFGIPKGAEKGEAYYEYEDPDGTVKE
IWRQVSLKLPLVRLMINRDKRLVKRELPEPXLLLPLFKPDRNLDDIMIQTSDIFSVTIHFEHLWITLTFG
Predicted Coding Sequence 
GGTATTCCCCCTGATTTGGGGGATAACCCGTATTTCCGCCCTTTGAGTGAGGCTGATACCGTTTGCCCAACCAGAAGGACCGAGGGCAGC
GAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATTACGAAACCGGCTTTTCCCCGNGCXGTTGGCCGATTCATTAATGCAGCTGGCACG
ACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTAT
GCTTCCGGCCGTATGTTGTGTGGAATTGTGACGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTA
ACCCTCACTAAAGGGAACAAAAGCTGGAGCTCCACCGCGGTGGCGGCCGCTXCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGC
ACGAGGGGAGAGGGTTTTGGAATACCAAAGGGAGCTGAAAAAGGTGAAGCATACTATGAATATGAGGACCCAGATGGAACAGTAAAAGAA
ATTTGGCGACAGGTTTCTTTGAAGTTGCCACTTGTTAGGTTAATGATCAATCGTGATAAACGTCTTGTGAAAAGAGAGTTACCTGAACCA
GAXTTGCTCTTGCCTCTGTTCAAACCAGACAGGAATCTTGACGACATTATGATCCAGACTAGTGACATTTTCTCAGTCACCATCCACTTT
GAGCATTTGTGGATCACCCTGACTTTCGGGTAA
Edits in Original Sequence 
(5')GGTATTCCCCCTGATTTcGGGGGATAACCCGTATTTCCGCCCTTTGAGTGAGGCTGATACCGTTTGCCgCAACCAGAAGGACCGAG
GGCAGCGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATTACGAAACCGGCTTTTCCCCGNGCXGTTGGCCGATTCATTAATGCAGCT
GGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGtGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTAC
ACTTTATGCTTCCGGCtCGTATGTTGTGTGGAATTGTGAgCGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGC
TCGAAATTAACCCTCACTAAAGGGAACAAAAGCTGGAGCTCCACCGCGGTGGCGGCCGCTXCTAGAACTAGTGGATCCCCCGGGCTGCAG
GAATTCGGCACGAGGGGAGAGGGTTTTGGAATACCAAAGGGAGCTGAAAAAGGTGAAGCAtTACTATGAATATGAGGACCCAGATGGAAC
AGTAAAAGAAATTTGGCGACAGGTTTCTTTGAAGTTGCCACTTGTTAGGTTAATGATCAATCGTGATAAACGTCTTGTGAAAAGAGAGTT
ACCTGAACCAGAXTTGCTCTTGCCTCTGTTCAAACCAGACAGGAATCTTGACGACATTATGATCCAGACTAGTGACATTTTCTCAGTCAC
CATCCACTTTGAGCATTTGTGGATCACCCTGACTTTCGGGTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan