ESTScan Details for Unigene SGN-U342993

Score 
8
Direction 
Forward
Predicted Peptide Sequence 
MAXXXKXXXXXXXXXKKNLEGGPXAPIRPIVSRLTIHWPAFYNGGTGKTLAVPPLNRFAAQSPFANWRINKRPADRPSKNCPT
Predicted Coding Sequence 
ATGGCTCNNNNNNNNAAAANNANNNNNNNNAANANNNNANNNNANAAAAAAAACCTCGAGGGGGGGCCCGXGGCCCCAATTCGCCCTATA
GTGAGTCGTTTAACAATTCACTGGCCCGCGTTTTACAACGGCGGGACTGGGAAAACCCTGGCXGTTCCCCCACTTAATCGCTTTGCAGCA
CAATCCCCTTTTGCCAACTGGCGTATTAACAAAAGGCCCGCCGATCGCCCTTCCAAAAATTGCCCAACCTGA
Edits in Original Sequence 
CAGCAAATTCCCAAATCAAAAATACAATTGCTCTCACTTCTCTCTAAAATTCTCTCCCTACACAAATCCTCCATGGAAGAACCTTGATGT
TCCAAGGAAAAAGATCAATTCTCCAAGTTTTCAATCCAAATTTCGTCGATAGGACTTAAATATAGTATGGTGATTTAATCCTTGATTCTT
CTCTCATTCAAGGATCCAATCTGAAAGACATTCCAAAATATCTCAAGAACCCTAAAACCCCTATTTTGGATTCTAAGCATGTGTTCCTAC
ATTAGAAGGTGGTGGCAAGTGAGGATTTCTAGAGTTGAAGCTTGTGAAGTATTCTCTCAAGATTGGTATCTCCTCATATGTTCGAGGACA
TGGATTTTATTTCTACTTCGCTTTTATTAAAGACTTTGTATTAGACTATGAGTTTCTTTTTAATGTAAGAGCCATGACCCTATAATAATG
AAATCTGTCTAAGA
(5')ATGGCTCNNNNNNNNAAAANNANNNNNNNNAANANNNNANNNNANAAAAAAAACCTCGAGGGGGGGCCCGXG
GCCCCAATTCGCCCTATAGTGAGTCGTTTAACAATTCACTGGCCCGCGTTTTACAACGGCGGGACTGGGAAAACCCTGGCXGTTCCCCCA
CTTAATCGCTTTGCAGCACAATCCCCTTTTGCCAACTGGCGTATTAACAAAAGGCCCGcCCGATCGCCCTTCCAAAAATTGCCCAACCTG
A(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan