ESTScan Details for Unigene SGN-U343146

Score 
414
Direction 
Forward
Predicted Peptide Sequence 
AGAPRGGGRSRTSGSPGLQDSDEEKSVAHHTVNLLTSTIKVDADQSDLRFCFRIISPTKSYTLQAESALDQMDWIEKITGVIASLLSSQA
PDRCLTASPMGSGHHRSASESSSFESSDFDPPAVEDHPSDRLISAHHDRPFRNSQQLRSAPKSEQPIATLRRVCGNDRCADCGAAEPDWA
SLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWEPSXIALFQSXGDTFANSVWEESLQARGAFKVMFRLAAHTDLKTATALLSKPSH
ADSFSPGRILPCKDGDNLCSSDQDVPRGPMX
Predicted Coding Sequence 
GCTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGATTCGGACGAGGAAAAGTCTGTTGCTCATCAC
ACTGTAAACCTTTTGACATCAACTATAAAGGTTGATGCTGACCAATCAGATCTGCGGTTTTGCTTCAGGATTATCTCCCCTACAAAGAGC
TACACCTTGCAGGCAGAGAGTGCCTTGGACCAAATGGATTGGATTGAGAAAATAACAGGAGTTATTGCTTCTTTGTTGAGTTCTCAGGCC
CCTGACAGGTGTTTGACTGCCAGTCCTATGGGAAGTGGTCATCATCGATCTGCCAGTGAGAGCAGTTCATTTGAAAGTTCAGATTTTGAC
CCGCCTGCAGTTGAAGACCATCCGTCTGACAGGCTTATCTCAGCGCATCATGATCGCCCTTTCAGAAATTCACAGCAGCTACGATCTGCT
CCAAAAAGTGAACAGCCAATTGCCACACTACGTAGAGTATGTGGAAATGATAGATGCGCTGACTGTGGTGCTGCTGAACCAGATTGGGCA
TCTTTAAATCTTGGTGTTCTTGTTTGTATTGAATGTTCAGGTGTTCATCGTAATCTTGGTGTGCATATATCAAAGGTGAGGTCACTCACA
CTTGATGTCAAAGTGTGGGAGCCTTCTGNTATAGCTTTATTTCAGTCGNTGGGGGATACCTTTGCAAATTCAGTCTGGGAAGAGTCACTG
CAAGCTCGAGGTGCTTTCAAGGTTATGTTTCGGCTTGCAGCTCATACAGATCTGAAAACAGCAACAGCTCTACTCAGCAAGCCAAGTCAT
GCTGATTCATTTTCACCAGGGAGAATTCTTCCCTGCAAAGATGGCGATAATCTTTGTTCGTCGGACCAGGATGTCCCCCGGGGGCCAATG
AXX
Edits in Original Sequence 
(5')GCTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGATTCGGcACGAGGAAAAGTCTGTTGCTC
ATCACACTGTAAACCTTTTGACATCAACTATAAAGGTTGATGCTGACCAATCAGATCTGCGGTTTTGCTTCAGGATTATCTCCCCTACAA
AGAGCTACACCTTGCAGGCAGAGAGTGCCTTGGACCAAATGGATTGGATTGAGAAAATAACAGGAGTTATTGCTTCTTTGTTGAGTTCTC
AGGCCCCTGACAGGTGTTTGACTGCCAGTCCTATGGGAAGTGGTCATCATCGATCTGCCAGTGAGAGCAGTTCATTTGAAAGTTCAGATT
TTGACCCGCCTGCAGTTGAAGACCATCCGTCTGACAGGCTTATCTCAGCGCATCATGATCGCCCTTTCAGAAATTCACAGCAGCTACGAT
CTGCTCCAAAAAGTGAACAGCCAATTGCCACACTACGTAGAGTATGTGGAAATGATAGATGCGCTGACTGTGGTGCTGCTGAACCAGATT
GGGCATCTTTAAATCTTGGTGTTCTTGTTTGTATTGAATGTTCAGGTGTTCATCGTAATCTTGGTGTGCATATATCAAAGGTGAGGTCAC
TCACACTTGATGTCAAAGTGTGGGAGCCTTCTGNTATAGCTTTATTTCAGTCGNTGGGGGATACCTTTGCAAATTCAGTCTGGGAAGAGT
CACTGCAAGCTCGAGGTGCTTTCAAGGTTATGTTTCGGCTTGCAGCTCATACAGATCTGAtAAACAGCAACAGCTCTACTCAGCAAGCCA
AGTCATGCTGATTCATTTTCACCAGGGAGAATTCTTCCCTGCAAAGATGGCGATAATCaTTTGTTCGTCGGACCAGGATGTCCCCCGGGG
GCCAATGAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan